ATG4A Antibody - N-terminal region (ARP42689_P050)

• Product Number: ARP42689_P050
• Name: ATG4A Antibody - N-terminal region (ARP42689_P050)
• Protein Size (# AA): 398 amino acids
• Molecular Weight: 45kDa
• NCBI Gene Id: 115201
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: ATG4 autophagy related 4 homolog A (S. cerevisiae)
• Alias Symbols: APG4A, AUTL2
• Peptide Sequence: Synthetic peptide located within the following region: DAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Dunham,I., (2007) EMBO J. 26 (7), 1749-1760
• Description of Target: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. ATG4A is a member of the autophagin protein family. ATG4A is also designated as a member of the C-54 family of cysteine proteases.Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Transcript variants that encode distinct isoforms have been identified.
• Protein Interactions: CDKL3; GABARAPL1; GABARAPL2; ATG101; MAP1LC3B;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ATG4A (ARP42689_P050) antibody is Catalog # AAP42689 (Previous Catalog # AAPP24921)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATG4A
• Uniprot ID: Q8WYN0
• Protein Name: Cysteine protease ATG4A
• Protein Accession #: NP_443168
• Purification: Affinity Purified
• Nucleotide Accession #: NM_052936
• Tested Species Reactivity: Human
• Gene Symbol: ATG4A
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 79%
• Image 1: Human Heart
  
  WB Suggested Anti-ATG4A Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human heart