| Product Number |
ARP42659_P050 |
| Product Page |
www.avivasysbio.com/nrbf2-antibody-n-terminal-region-arp42659-p050.html |
| Name |
Nrbf2 Antibody - N-terminal region (ARP42659_P050) |
| Protein Size (# AA) |
287 amino acids |
| Molecular Weight |
32kDa |
| NCBI Gene Id |
641340 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Nuclear receptor binding factor 2 |
| Alias Symbols |
NRBF-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: EGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKLTESEQAH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Nrbf2 may modulate transcriptional activation by target nuclear receptors. Can act as transcriptional activator (in vitro). |
| Protein Interactions |
PRKAA1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Nrbf2 (ARP42659_P050) antibody |
| Blocking Peptide |
For anti-Nrbf2 (ARP42659_P050) antibody is Catalog # AAP42659 |
| Uniprot ID |
Q8VCQ3 |
| Protein Name |
Nuclear receptor-binding factor 2 |
| Protein Accession # |
NP_001031370 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001036293 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Nrbf2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83% |
| Image 1 | Mouse Pancreas
 | WB Suggested Anti-Nrbf2 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Pancreas |
|
|
