C6orf134 Antibody - N-terminal region (ARP42641_P050)

• Product Number: ARP42641_P050
• Name: C6orf134 Antibody - N-terminal region (ARP42641_P050)
• Protein Size (# AA): 323 amino acids
• Molecular Weight: 36kDa
• NCBI Gene Id: 79969
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Alpha tubulin acetyltransferase 1
• Alias Symbols: TAT, MEC17, C6orf134, Nbla00487, alpha-TAT, alpha-TAT1
• Peptide Sequence: Synthetic peptide located within the following region: MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The exact function of C6orf134 remains unknown.
• Protein Interactions: SRPK2; APP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ATAT1 (ARP42641_P050) antibody is Catalog # AAP42641 (Previous Catalog # AAPP11569)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf134
• Uniprot ID: Q5SQI0
• Protein Name: Alpha-tubulin N-acetyltransferase
• Publications:

  Kalebic, N. et al. Tubulin acetyltransferase aTAT1 destabilizes microtubules independently of its acetylation activity. Mol. Cell. Biol. 33, 1114-23 (2013). 23275437

• Protein Accession #: NP_079185
• Purification: Affinity Purified
• Nucleotide Accession #: NM_024909
• Tested Species Reactivity: Human
• Gene Symbol: ATAT1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human ACHN
  
  WB Suggested Anti-C6orf134 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: ACHN cell lysate