CHIA Antibody - N-terminal region (ARP42601_P050)

Data Sheet
 
Product Number ARP42601_P050
Product Page www.avivasysbio.com/chia-antibody-n-terminal-region-arp42601-p050.html
Name CHIA Antibody - N-terminal region (ARP42601_P050)
Protein Size (# AA) 368 amino acids
Molecular Weight 40kDa
NCBI Gene Id 27159
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Chitinase, acidic
Alias Symbols CHIT2, AMCASE, TSA1902
Peptide Sequence Synthetic peptide located within the following region: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Chou,Y.T., (2006) Biochemistry 45 (14), 4444-4454
Description of Target CHIA belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. It contains 1 chitin-binding type-2 domain. The protein degrades chitin and chitotriose. And it may participate in the defense against nematodes and other pathogens.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CHIA (ARP42601_P050) antibody
Blocking Peptide For anti-CHIA (ARP42601_P050) antibody is Catalog # AAP42601 (Previous Catalog # AAPP24837)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CHIA
Uniprot ID Q9BZP6
Protein Name Acidic mammalian chitinase
Publications

Fukushima, T., Nashida, T., Haga-Tsujimura, M. & Mataga, I. Chitinase expression in parotid glands of non-obese diabetic mice. Oral Dis. 18, 506-12 (2012). 22309644

Strobel, S., Roswag, A., Becker, N. I., Trenczek, T. E. & Encarnação, J. A. Insectivorous bats digest chitin in the stomach using acidic mammalian chitinase. PLoS One 8, e72770 (2013). 24019876

Protein Accession # NP_068569
Purification Affinity Purified
Nucleotide Accession # NM_021797
Tested Species Reactivity Human
Gene Symbol CHIA
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Zebrafish: 86%
Image 1
Human Fetal Heart
Host: Rabbit
Target Name: CHIA
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml
Image 2
Human Fetal Lung
Host: Rabbit
Target Name: CHIA
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml
Image 3
Human Fetal Liver
Host: Rabbit
Target Name: CHIA
Sample Type: Human Fetal Liver
Antibody Dilution: 1.0ug/ml
Image 4
Transfected 293T
WB Suggested Anti-CHIA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com