| Product Number |
ARP42526_P050 |
| Product Page |
www.avivasysbio.com/cemip-antibody-middle-region-arp42526-p050.html |
| Name |
CEMIP Antibody - middle region (ARP42526_P050) |
| Protein Size (# AA) |
1361 amino acids |
| Molecular Weight |
153 kDa |
| NCBI Gene Id |
57214 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
cell migration inducing hyaluronidase 1 |
| Description |
|
| Alias Symbols |
CCSP1, HYBID, TMEM2L, KIAA1199 |
| Peptide Sequence |
Synthetic peptide located within the following region: PFLSIISARYSPHQDADPLKPREPAIIRHFIAYKNQDHGAWLRGGDVWLD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Protein Interactions |
DCUN1D1; PLXNA2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
|
| Datasheets/Manuals |
Printable datasheet for anti-CEMIP (ARP42526_P050) antibody |
| Blocking Peptide |
For anti-CEMIP (ARP42526_P050) antibody is Catalog # AAP42526 (Previous Catalog # AAPP11015) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human KIAA1199 |
| Uniprot ID |
Q8WUJ3 |
| Protein Name |
cell migration-inducing and hyaluronan-binding protein |
| Publications |
KIAA1199 expression and hyaluronan degradation colocalize in multiple sclerosis lesions. Glycobiology. 28, 958-967 (2018). 30007349 |
| Sample Type Confirmation |
KIAA1199 is supported by BioGPS gene expression data to be expressed in COLO205 |
| Protein Accession # |
NP_061159 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_018689 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CEMIP |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 85% |
| Image 1 | Human OVCAR-3
 | Host: Rabbit
Target Name: KIAA1199
Sample Tissue: Human OVCAR-3
Antibody Dilution: 1.0ug/ml |
|
