FERMT1 Antibody - N-terminal region (ARP42485_P050)

Data Sheet
 
Product Number ARP42485_P050
Product Page www.avivasysbio.com/fermt1-antibody-n-terminal-region-arp42485-p050.html
Name FERMT1 Antibody - N-terminal region (ARP42485_P050)
Protein Size (# AA) 677 amino acids
Molecular Weight 77kDa
NCBI Gene Id 55612
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Fermitin family member 1
Alias Symbols URP1, KIND1, DTGCU2, UNC112A, C20orf42
Peptide Sequence Synthetic peptide located within the following region: LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQIN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Martignago,B.C., (2007) Br. J. Dermatol. 157 (6), 1281-1284
Description of Target FERMT1 is involved in cell adhesion, possibly via its interaction with integrins. It may mediate TGF-beta 1 signaling in tumor progression. Defects in FERMT1 are the cause of Kindler syndrome.
Protein Interactions SRPK1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FERMT1 (ARP42485_P050) antibody
Blocking Peptide For anti-FERMT1 (ARP42485_P050) antibody is Catalog # AAP42485 (Previous Catalog # AAPS12811)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FERMT1
Uniprot ID Q9BQL6
Protein Name Fermitin family homolog 1
Protein Accession # NP_060141
Purification Affinity Purified
Nucleotide Accession # NM_017671
Tested Species Reactivity Human
Gene Symbol FERMT1
Predicted Species Reactivity Human, Rat, Cow, Dog, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Rabbit: 93%; Rat: 79%
Image 1
Human Heart
WB Suggested Anti-FERMT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com