Product Number |
ARP42485_P050 |
Product Page |
www.avivasysbio.com/fermt1-antibody-n-terminal-region-arp42485-p050.html |
Name |
FERMT1 Antibody - N-terminal region (ARP42485_P050) |
Protein Size (# AA) |
677 amino acids |
Molecular Weight |
77kDa |
NCBI Gene Id |
55612 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Fermitin family member 1 |
Alias Symbols |
URP1, KIND1, DTGCU2, UNC112A, C20orf42 |
Peptide Sequence |
Synthetic peptide located within the following region: LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQIN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Martignago,B.C., (2007) Br. J. Dermatol. 157 (6), 1281-1284 |
Description of Target |
FERMT1 is involved in cell adhesion, possibly via its interaction with integrins. It may mediate TGF-beta 1 signaling in tumor progression. Defects in FERMT1 are the cause of Kindler syndrome. |
Protein Interactions |
SRPK1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-FERMT1 (ARP42485_P050) antibody |
Blocking Peptide |
For anti-FERMT1 (ARP42485_P050) antibody is Catalog # AAP42485 (Previous Catalog # AAPS12811) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FERMT1 |
Uniprot ID |
Q9BQL6 |
Protein Name |
Fermitin family homolog 1 |
Protein Accession # |
NP_060141 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_017671 |
Tested Species Reactivity |
Human |
Gene Symbol |
FERMT1 |
Predicted Species Reactivity |
Human, Rat, Cow, Dog, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Rabbit: 93%; Rat: 79% |
Image 1 | Human Heart
| WB Suggested Anti-FERMT1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human heart |
|
|