Cbr2 Antibody - N-terminal region (ARP42461_P050)

• Product Number: ARP42461_P050
• Name: Cbr2 Antibody - N-terminal region (ARP42461_P050)
• Protein Size (# AA): 244 amino acids
• Molecular Weight: 26kDa
• NCBI Gene Id: 12409
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Description:
  View product citations for Cbr2 Antibody - N-terminal region (ARP42461_P050) on CiteAb
• Alias Symbols: ML, MLCR
• Peptide Sequence: Synthetic peptide located within the following region: VCVDLGDWDATEKALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Cbr2 may function in the pulmonary metabolism of endogenous carbonyl compounds, such as aliphatic aldehydes and ketones derived from lipid peroxidation, 3-ketosteroids and fatty aldehydes, as well as in xenobiotic metabolism.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-Cbr2 (ARP42461_P050) antibody is Catalog # AAP42461
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Cbr2
• Uniprot ID: P08074
• Protein Name: Carbonyl reductase [NADPH] 2
• Publications:

  Genome-wide effect of pulmonary airway epithelial cell-specific Bmal1 deletion. FASEB J. 33, 6226-6238 (2019). 30794439

• Protein Accession #: NP_031647
• Purification: Affinity Purified
• Nucleotide Accession #: NM_007621
• Tested Species Reactivity: Mouse
• Gene Symbol: Cbr2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rat: 100%
• Image 1: Mouse Lung
  
  Host: Rabbit
  Target Name: Cbr2
  Sample Type: Mouse Lung lysates
  Antibody Dilution: 1.0ug/ml