MFN2 Antibody - C-terminal region (ARP42420_P050)

• Product Number: ARP42420_P050
• Name: MFN2 Antibody - C-terminal region (ARP42420_P050)
• Protein Size (# AA): 757 amino acids
• Molecular Weight: 86kDa
• NCBI Gene Id: 9927
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Mitofusin 2
• Alias Symbols: HSG, MARF, CMT2A, CPRP1, CMT2A2, HMSN6A, CMT2A2A, CMT2A2B
• Peptide Sequence: Synthetic peptide located within the following region: LEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Chung,K.W., (2008) Neurology 70 (21), 2010-2011
• Description of Target: MFN2 is a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. It is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke.This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified.
• Protein Interactions: UBC; MARCH5; PARK2; UBE2N; MFN2; TER94; MAVS; vpr; HUWE1; MAPK9;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MFN2 (ARP42420_P050) antibody is Catalog # AAP42420 (Previous Catalog # AAPP11559)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MFN2
• Uniprot ID: O95140
• Protein Name: Mitofusin-2
• Publications:

  Hepatitis C virus NS5A protein cooperates with phosphatidylinositol 4-kinase IIIa to induce mitochondrial fragmentation. Sci Rep. 6, 23464 (2016). 27010100

• Protein Accession #: NP_055689
• Purification: Affinity Purified
• Nucleotide Accession #: NM_014874
• Tested Species Reactivity: Human
• Gene Symbol: MFN2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Image 1: Human 293T
  
  WB Suggested Anti-MFN2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: 293T cell lysate
• Image 2: Human heart tissue
  
  Rabbit Anti-MFN2 Antibody
  Catalog Number: ARP42420_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Heart Tissue
  Observed Staining: Cytoplasm in cardiomyocytes
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: N/A
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec