| Product Number |
ARP42414_P050 |
| Product Page |
www.avivasysbio.com/rhod-antibody-c-terminal-region-arp42414-p050.html |
| Name |
RHOD Antibody - C-terminal region (ARP42414_P050) |
| Protein Size (# AA) |
210 amino acids |
| Molecular Weight |
23 kDa |
| NCBI Gene Id |
29984 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ras homolog family member D |
| Alias Symbols |
Rho, ARHD, RHOM, RHOHP1 |
| Peptide Sequence |
Synthetic peptide located within the following region: NGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tong,Y., (2007) J. Biol. Chem. 282 (51), 37215-37224 |
| Description of Target |
Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. RHOD binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. The protein encoded by this gene binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
ADRB2; IHH; ADCK5; UBC; PLXNA1; SMURF2; BMPR1B; SMAD2; SMAD4; DIAPH2; TGFBR1; HRAS; ACVR1; CNKSR1; ARHGAP29; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RHOD (ARP42414_P050) antibody |
| Blocking Peptide |
For anti-RHOD (ARP42414_P050) antibody is Catalog # AAP42414 (Previous Catalog # AAPP24760) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human RHOD |
| Uniprot ID |
O00212 |
| Protein Name |
Rho-related GTP-binding protein RhoD |
| Protein Accession # |
NP_055393 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_014578 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RHOD |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 82%; Rat: 100% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-RHOD Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T |
|
| Image 2 | Human Liver Tissue
 | RHOD antibody - C-terminal region (ARP42414_P050)
Catalog Number: ARP42414_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Cytoplasm in sinusoids of liver
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
| Image 3 | Human Bronchial Epithelial Tissue
 | RHOD antibody - C-terminal region (ARP42414_P050)
Catalog Number: ARP42414_P050
Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
Observed Staining: Cytoplasm and membrane of bronchial epithelial tissue
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
