Grem1 Antibody - C-terminal region (ARP42380_P050)

• Product Number: ARP42380_P050
• Name: Grem1 Antibody - C-terminal region (ARP42380_P050)
• Protein Size (# AA): 184 amino acids
• Molecular Weight: 21kDa
• NCBI Gene Id: 23892
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: Dr, ld, Drm, gre, Grem, Cktsf1b, Cktsf1b1
• Peptide Sequence: Synthetic peptide located within the following region: EEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Grem1 is a cytokine that may play an important role during carcinogenesis and metanephric kidney organogenesis, as BMP a antagonist required for early limb outgrowth and patterning in maintaining the FGF4-SHH feedback loop. It down-regulates the BMP4 signaling in a dose-dependent manner and acts as inhibitor of monocyte chemotaxis.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-Grem1 (ARP42380_P050) antibody is Catalog # AAP42380
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Grem1
• Uniprot ID: O70326
• Protein Name: Gremlin-1
• Protein Accession #: NP_035954
• Purification: Affinity Purified
• Nucleotide Accession #: NM_011824
• Tested Species Reactivity: Mouse
• Gene Symbol: Grem1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Image 1: Mouse Testis
  
  Host: Rabbit
  Target Name: Grem1
  Sample Type: Mouse Testis lysates
  Antibody Dilution: 1.0ug/ml