DMBT1 Antibody - N-terminal region (ARP42352_P050)

• Product Number: ARP42352_P050
• Name: DMBT1 Antibody - N-terminal region (ARP42352_P050)
• Protein Size (# AA): 2413 amino acids
• Molecular Weight: 258kDa
• NCBI Gene Id: 1755
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Deleted in malignant brain tumors 1
• Description:
  View product citations for DMBT1 Antibody - N-terminal region (ARP42352_P050) on CiteAb
• Alias Symbols: SAG, GP340, SALSA, muclin
• Peptide Sequence: Synthetic peptide located within the following region: SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Loss of sequences from human chromosome 10q has been associated with the progression of human cancers. The gene DMBT1 was originally isolated based on its deletion in a medulloblastoma cell line. DMBT1 is expressed with transcripts of 6.0, 7.5, and 8.0 kb in fetal lung and with one transcript of 8.0 kb in adult lung, although the 7.5 kb transcript has not been characterized. The DMBT1 protein is a glycoprotein containing multiple scavenger receptor cysteine-rich (SRCR) domains separated by SRCR-interspersed domains (SID). Transcript variant 2 (8.0 kb) has been shown to bind surfactant protein D independently of carbohydrate recognition. This indicates that DMBT1 may not be a classical tumor supressor gene, but rather play a role in the interaction of tumor cells and the immune system.
• Protein Interactions: CDK6; COPS6; SUMO2; UBC; PARD6B; SFTPD; SFTPA1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-DMBT1 (ARP42352_P050) antibody is Catalog # AAP42352 (Previous Catalog # AAPP12596)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DMBT1
• Uniprot ID: Q9UGM3
• Protein Name: Deleted in malignant brain tumors 1 protein
• Publications:

  Gonzalez-Gil, A et al. Isolation, identification and characterization of the human airway ligand for the eosinophil and mast cell immunoinhibitory receptor SIGLEC-8. J Allergy Clin Immunol. 2020 Aug 10 S0091-6749 (20) 31107-6. 32791164

• Protein Accession #: NP_015568
• Purification: Affinity Purified
• Nucleotide Accession #: NM_007329
• Tested Species Reactivity: Human
• Gene Symbol: DMBT1
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human Stomach
  
  WB Suggested Anti-DMBT1 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Human Stomach
• Image 2: Human
  
  Lanes:
  Lane 1: 2ug MCF7-DMBT1+Dox
  Lane 2: 2ug MCF7-DMBT1 -Dox
  Lane 3: 2ug MCF7-Ctrl+Dox
  Lane 4: 2ug MCF7-DMBT1 -Dox
  Primary Antibody Dilution:
  1:5000
  Secondary Antibody:
  Anti-rabbit HRP
  Secondary Antibody Dilution:
  1:10,000
  Gene Name:
  DMBT1
  Submitted by:
  Matthias Rauen, Lundbeckfonden Center of Excellence NanoCAN, University of Southern Denmark
  
• Image 3: Human Lung , HeLa Cell Lysate
  
  Host: Rabbit
  Target: DMBT1
  Positive control (+): Human Lung (LU)
  Negative control (-): HeLa Cell Lysate (HL)
  Antibody concentration: 1ug/ml
• Image 4: Human Human Stomach
  
  Host: Rabbit
  Target Name: DMBT1
  Sample Tissue: Human Human Stomach
  Antibody Dilution: 1ug/ml
• Image 5: Human HepG2 Whole Cell
  
  Host: Rabbit
  Target Name: DMBT1
  Sample Tissue: Human HepG2 Whole Cell
  Antibody Dilution: 3ug/ml
• Image 6:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.