| Product Number |
ARP42350_P050 |
| Product Page |
www.avivasysbio.com/snca-antibody-middle-region-arp42350-p050.html |
| Name |
SNCA Antibody - middle region (ARP42350_P050) |
| Protein Size (# AA) |
112 amino acids |
| Molecular Weight |
11kDa |
| NCBI Gene Id |
6622 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Synuclein, alpha (non A4 component of amyloid precursor) |
| Alias Symbols |
PD1, NACP, PARK1, PARK4 |
| Peptide Sequence |
Synthetic peptide located within the following region: VTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Wu,K.P., (2008) J. Mol. Biol. 378 (5), 1104-1115 |
| Description of Target |
Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease.Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Two alternatively spliced transcripts of SNCA have been identified. Additional splicing may be present but the full-length nature of these variants has not been determined. |
| Protein Interactions |
NEDD4L; UBC; NEDD4; SNCA; GAPDH; HPRT1; CHMP5; KLK6; PARK7; LAMP2; CDC5; SLG1; PLK2; SAC7; TUS1; ROM2; MID2; Csnk2b; Lyn; Fgr; Csnk1g3; Syk; Rab5a; YWHAQ; ARPP19; RABAC1; TUBA1B; CALM; ACTA1; HIST2H3C; TUBB1; BDH2; USP47; SAP30BP; PELP1; SIN3A; Rab3a; ENC |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SNCA (ARP42350_P050) antibody |
| Blocking Peptide |
For anti-SNCA (ARP42350_P050) antibody is Catalog # AAP42350 (Previous Catalog # AAPP24705) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SNCA |
| Uniprot ID |
P37840-2 |
| Protein Name |
Alpha-synuclein |
| Protein Accession # |
NP_009292 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007308 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SNCA |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-SNCA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate |
|
| Image 2 | Human Fetal Liver
 | Host: Rabbit
Target Name: FAM46C
Sample Type: Human Fetal Liver
Antibody Dilution: 1.0ug/ml |
|
