PAGE4 Antibody - N-terminal region (ARP42335_P050)

Data Sheet
 
Product Number ARP42335_P050
Product Page www.avivasysbio.com/page4-antibody-n-terminal-region-arp42335-p050.html
Name PAGE4 Antibody - N-terminal region (ARP42335_P050)
Protein Size (# AA) 102 amino acids
Molecular Weight 11kDa
NCBI Gene Id 9506
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name P antigen family, member 4 (prostate associated)
Alias Symbols JM27, JM-27, CT16.7, GAGE-9, GAGEC1, PAGE-1, PAGE-4
Peptide Sequence Synthetic peptide located within the following region: DGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer. It is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. The protein may play a role in benign and malignant prostate diseases. A related pseudogene is located on chromosome 7.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PAGE4 (ARP42335_P050) antibody
Blocking Peptide For anti-PAGE4 (ARP42335_P050) antibody is Catalog # AAP42335
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human PAGE4
Uniprot ID O60829
Protein Name G antigen family C member 1
Protein Accession # XP_005278137
Purification Affinity Purified
Tested Species Reactivity Human
Gene Symbol PAGE4
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Thymus Tumor
Host: Rabbit
Target Name: PAGE4
Sample Type: Thymus Tumor lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com