Product Number |
ARP42335_P050 |
Product Page |
www.avivasysbio.com/page4-antibody-n-terminal-region-arp42335-p050.html |
Name |
PAGE4 Antibody - N-terminal region (ARP42335_P050) |
Protein Size (# AA) |
102 amino acids |
Molecular Weight |
11kDa |
NCBI Gene Id |
9506 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
P antigen family, member 4 (prostate associated) |
Alias Symbols |
JM27, JM-27, CT16.7, GAGE-9, GAGEC1, PAGE-1, PAGE-4 |
Peptide Sequence |
Synthetic peptide located within the following region: DGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer. It is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. The protein may play a role in benign and malignant prostate diseases. A related pseudogene is located on chromosome 7. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PAGE4 (ARP42335_P050) antibody |
Blocking Peptide |
For anti-PAGE4 (ARP42335_P050) antibody is Catalog # AAP42335 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PAGE4 |
Uniprot ID |
O60829 |
Protein Name |
G antigen family C member 1 |
Protein Accession # |
XP_005278137 |
Purification |
Affinity Purified |
Tested Species Reactivity |
Human |
Gene Symbol |
PAGE4 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Thymus Tumor
| Host: Rabbit Target Name: PAGE4 Sample Type: Thymus Tumor lysates Antibody Dilution: 1.0ug/ml |
|
|