PRSS16 Antibody - N-terminal region (ARP42265_P050)

• Product Number: ARP42265_P050
• Name: PRSS16 Antibody - N-terminal region (ARP42265_P050)
• Protein Size (# AA): 514 amino acids
• Molecular Weight: 56kDa
• NCBI Gene Id: 10279
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: serine protease 16
• Alias Symbols: TSSP
• Peptide Sequence: Synthetic peptide located within the following region: QDGPIFLHLGGEGSLGPGSVMRGHPAALAPAWGALVISLEHRFYGLSIPA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a serine protease expressed exclusively in the thymus. It is thought to play a role in the alternative antigen presenting pathway used by cortical thymic epithelial cells during the positive selection of T cells. The gene is found in the large histone gene cluster on chromosome 6, near the major histocompatibility complex (MHC) class I region. A second transcript variant has been described, but its full length nature has not been determined.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PRSS16 (ARP42265_P050) antibody is Catalog # AAP42265
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TSSP
• Uniprot ID: Q9NQE7
• Protein Name: thymus-specific serine protease
• Protein Accession #: NP_005856
• Purification: Affinity purified
• Tested Species Reactivity: Human
• Gene Symbol: PRSS16
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Image 1: Human Ovary Tumor
  
  Host: Rabbit
  Target Name: TSSP
  Sample Type: Ovary Tumor lysates
  Antibody Dilution: 1.0ug/ml