| Product Number |
ARP42260_P050-HRP |
| Product Page |
www.avivasysbio.com/calcrl-antibody-n-terminal-region-hrp-arp42260-p050-hrp.html |
| Name |
CALCRL Antibody - N-terminal region : HRP (ARP42260_P050-HRP) |
| Protein Size (# AA) |
461 amino acids |
| Molecular Weight |
53kDa |
| Conjugation |
HRP: Horseradish Peroxidase |
| NCBI Gene Id |
10203 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Calcitonin receptor-like |
| Alias Symbols |
CRLR, CGRPR, LMPHM8 |
| Peptide Sequence |
Synthetic peptide located within the following region: DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL |
| Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Reference |
Eskesen,K., Ideggyogy Sz 60 (11-12), 459-466 (2007) |
| Description of Target |
CALCRL is the receptor for calcitonin-gene-related peptide (CGRP) together with RAMP1 and receptor for adrenomedullin together with RAMP2 or RAMP3. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. |
| Protein Interactions |
CALCA; CRCP; RAMP3; RAMP2; RAMP1; ADM; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-CALCRL (ARP42260_P050-HRP) antibody |
| Blocking Peptide |
For anti-CALCRL (ARP42260_P050-HRP) antibody is Catalog # AAP42260 (Previous Catalog # AAPP24681) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CALCRL |
| Uniprot ID |
Q16602 |
| Protein Name |
Calcitonin gene-related peptide type 1 receptor |
| Protein Accession # |
NP_005786 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005795 |
| Gene Symbol |
CALCRL |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 90% |
| Image 1 | |
|
