| Product Number |
ARP42260_P050 |
| Product Page |
www.avivasysbio.com/calcrl-antibody-n-terminal-region-arp42260-p050.html |
| Name |
CALCRL Antibody - N-terminal region (ARP42260_P050) |
| Protein Size (# AA) |
461 amino acids |
| Molecular Weight |
53kDa |
| NCBI Gene Id |
10203 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Calcitonin receptor-like |
| Description |
|
| Alias Symbols |
CRLR, CGRPR, LMPHM8 |
| Peptide Sequence |
Synthetic peptide located within the following region: DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Eskesen,K., Ideggyogy Sz 60 (11-12), 459-466 (2007) |
| Description of Target |
CALCRL is the receptor for calcitonin-gene-related peptide (CGRP) together with RAMP1 and receptor for adrenomedullin together with RAMP2 or RAMP3. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. |
| Protein Interactions |
CALCA; CRCP; RAMP3; RAMP2; RAMP1; ADM; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CALCRL (ARP42260_P050) antibody |
| Blocking Peptide |
For anti-CALCRL (ARP42260_P050) antibody is Catalog # AAP42260 (Previous Catalog # AAPP24681) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CALCRL |
| Uniprot ID |
Q16602 |
| Protein Name |
Calcitonin gene-related peptide type 1 receptor |
| Protein Accession # |
NP_005786 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005795 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CALCRL |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 90% |
| Image 1 | Human Muscle
 | WB Suggested Anti-CALCRL Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Muscle |
|
| Image 2 | Human 786-0 Whole Cell
 | Host: Rabbit
Target Name: CALCRL
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 3ug/ml |
|
| Image 3 | Human Lung Tumor
 | Host: Rabbit
Target Name: CALCRL
Sample Tissue: Human Lung Tumor
Antibody Dilution: 1ug/ml |
|
| Image 4 | Human Ovary Tumor
 | Host: Rabbit
Target Name: CALCRL
Sample Tissue: Human Ovary Tumor
Antibody Dilution: 1ug/ml |
|
