HP Antibody - N-terminal region (ARP42218_P050)

• Product Number: ARP42218_P050
• Name: HP Antibody - N-terminal region (ARP42218_P050)
• Protein Size (# AA): 406 amino acids
• Molecular Weight: 60 kDa
• NCBI Gene Id: 3240
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Haptoglobin
• Alias Symbols: BP, HPA1S, HP2ALPHA2
• Peptide Sequence: Synthetic peptide located within the following region: MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Borsody,M., (2006) Neurology 66 (5), 634-640
• Description of Target: Haptoglobin combines with free plasma hemoglobin, preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin, while making the hemoglobin accessible to degradative enzymes.
• Protein Interactions: GADD45G; LAMC3; MVP; WASL; TP63; TGM2; TBL1X; RPL11; SMAD3; ALB; VKORC1; ATP7B; ELAVL1; RBBP6; GRB2; MIS12; C1RL; CD163; ADAMTS4; ITGB2; HBB; ITGAM; CD22;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-HP (ARP42218_P050) antibody is Catalog # AAP42218 (Previous Catalog # AAPP24641)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HP
• Uniprot ID: P00738
• Protein Name: Haptoglobin
• Protein Accession #: NP_005134
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005143
• Tested Species Reactivity: Human
• Gene Symbol: HP
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Dog: 77%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Mouse: 92%; Pig: 85%; Rabbit: 92%; Rat: 92%
• Image 1: Human Liver Tissue
  
  HP (haptoglobin)antibody - N-terminal region (ARP42218_P050)
  Catalog Number: ARP42218_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
  Observed Staining: Cytoplasm in hepatocytes
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
• Image 2:
  
  25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.