Product Number |
ARP42215_P050 |
Product Page |
www.avivasysbio.com/gfpt2-antibody-middle-region-arp42215-p050.html |
Name |
GFPT2 Antibody - middle region (ARP42215_P050) |
Protein Size (# AA) |
682 amino acids |
Molecular Weight |
77kDa |
NCBI Gene Id |
9945 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Glutamine-fructose-6-phosphate transaminase 2 |
Alias Symbols |
GFAT, GFAT2, GFAT 2 |
Peptide Sequence |
Synthetic peptide located within the following region: TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Srinivasan,V., Clin. Biochem. 40 (13-14), 952-957 (2007) |
Description of Target |
GFPT2 controls the flux of glucose into the hexosamine pathway. GFPT2 is most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins. |
Protein Interactions |
UBC; DCP2; CUL3; POT1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GFPT2 (ARP42215_P050) antibody |
Blocking Peptide |
For anti-GFPT2 (ARP42215_P050) antibody is Catalog # AAP42215 (Previous Catalog # AAPP24638) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GFPT2 |
Uniprot ID |
O94808 |
Protein Name |
Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 |
Sample Type Confirmation |
GFPT2 is supported by BioGPS gene expression data to be expressed in HT1080 |
Protein Accession # |
NP_005101 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_005110 |
Tested Species Reactivity |
Human |
Gene Symbol |
GFPT2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Human HT1080
| WB Suggested Anti-GFPT2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: HT1080 cell lysateGFPT2 is supported by BioGPS gene expression data to be expressed in HT1080 |
|
Image 2 | Human Skin
| Rabbit Anti-GFPT2 antibody Catalog Number: ARP42215 Formalin Fixed Paraffin Embedded Tissue: Human Skin Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec
|
|