GFPT2 Antibody - middle region (ARP42215_P050)

Data Sheet
 
Product Number ARP42215_P050
Product Page www.avivasysbio.com/gfpt2-antibody-middle-region-arp42215-p050.html
Name GFPT2 Antibody - middle region (ARP42215_P050)
Protein Size (# AA) 682 amino acids
Molecular Weight 77kDa
NCBI Gene Id 9945
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Glutamine-fructose-6-phosphate transaminase 2
Alias Symbols GFAT, GFAT2, GFAT 2
Peptide Sequence Synthetic peptide located within the following region: TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Srinivasan,V., Clin. Biochem. 40 (13-14), 952-957 (2007)
Description of Target GFPT2 controls the flux of glucose into the hexosamine pathway. GFPT2 is most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins.
Protein Interactions UBC; DCP2; CUL3; POT1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GFPT2 (ARP42215_P050) antibody
Blocking Peptide For anti-GFPT2 (ARP42215_P050) antibody is Catalog # AAP42215 (Previous Catalog # AAPP24638)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GFPT2
Uniprot ID O94808
Protein Name Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2
Sample Type Confirmation

GFPT2 is supported by BioGPS gene expression data to be expressed in HT1080

Protein Accession # NP_005101
Purification Affinity Purified
Nucleotide Accession # NM_005110
Tested Species Reactivity Human
Gene Symbol GFPT2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human HT1080
WB Suggested Anti-GFPT2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HT1080 cell lysateGFPT2 is supported by BioGPS gene expression data to be expressed in HT1080
Image 2
Human Skin
Rabbit Anti-GFPT2 antibody
Catalog Number: ARP42215
Formalin Fixed Paraffin Embedded Tissue: Human Skin
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com