PLPP1 Antibody - middle region (ARP42146_T100)

Data Sheet
 
Product Number ARP42146_T100
Product Page www.avivasysbio.com/plpp1-antibody-middle-region-arp42146-t100.html
Name PLPP1 Antibody - middle region (ARP42146_T100)
Protein Size (# AA) 285 amino acids
Molecular Weight 31kDa
NCBI Gene Id 8611
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name phospholipid phosphatase 1
Alias Symbols LPP1, PAP2, LLP1a, PAP-2a, PPAP2A
Peptide Sequence Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Tanyi,J.L., Clin. Cancer Res. 9 (10 PT 1), 3534-3545 (2003)
Description of Target The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in synthesis of glycerolipids and in phospholipase D-mediated signal transduction. This enzyme is an integral membrane glycoprotein that plays a role in the hydrolysis and uptake of lipids from extracellular space. Alternate splicing results in multiple transcript variants of this gene.
Protein Interactions FAHD1; IGF2BP2; ILF3; UBC; FXYD1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PLPP1 (ARP42146_T100) antibody
Blocking Peptide For anti-PLPP1 (ARP42146_T100) antibody is Catalog # AAP42146 (Previous Catalog # AAPP12565)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PPAP2A
Uniprot ID O14494-2
Protein Name phospholipid phosphatase 1
Protein Accession # NP_795714
Purification Protein A purified
Nucleotide Accession # NM_176895
Tested Species Reactivity Human, Mouse
Gene Symbol PLPP1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-PPAP2A Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate
Image 2
Mouse
Sample Type: Mouse primary tissue, focusing in pLNPrimary
Dilution: 1mg/mLSecondary
Dilution: 125ug/mL
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com