SLC2A5 Antibody (ARP42096_P050)

• Product Number: ARP42096_P050
• Name: SLC2A5 Antibody (ARP42096_P050)
• Protein Size (# AA): 501 amino acids
• Molecular Weight: 55 kDa
• NCBI Gene Id: 6518
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Solute carrier family 2 (facilitated glucose/fructose transporter), member 5
• Alias Symbols: GLUT5, GLUT-5
• Peptide Sequence: Synthetic peptide located within the following region: ADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Fu,Y., (2004) Blood Cells Mol. Dis. 32 (1), 182-190
• Description of Target: SLC2A5 is a cytochalasin B-sensitive carrier. It seems to function primarily as a fructose transporter.
• Protein Interactions: CCL5; RPSA;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR	Y
  YCHAROS

• Blocking Peptide: For anti-SLC2A5 (ARP42096_P050) antibody is Catalog # AAP42096 (Previous Catalog # AAPP24575)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC2A5
• Uniprot ID: P22732
• Protein Name: Solute carrier family 2, facilitated glucose transporter member 5
• Protein Accession #: NP_003030
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003039
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: SLC2A5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Sheep
• Application: IF, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 85%
• Image 1: Human Jurkat
  
  WB Suggested Anti-SLC2A5 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Mouse HEI-OCI
  
  Auditory HEI-OCI
• Image 3:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.