SEMG1 antibody - N-terminal region (ARP42088_T100)
Data Sheet
Product Number ARP42088_T100
Product Page
Product Name SEMG1 antibody - N-terminal region (ARP42088_T100)
Size 100 ul
Gene Symbol SEMG1
Alias Symbols MGC14719, SEMG, SGI, CT103, dJ172H20.2
Protein Size (# AA) 462 amino acids
Molecular Weight 51kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 6406
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Semenogelin I
Description This is a rabbit polyclonal antibody against SEMG1. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: QKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHL
Target Reference Hienonen,T., (2005) Cancer Res. 65 (11), 4607-4613
Description of Target SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly having a separate function. The proteolysis process breaks down the gel matrix and allows the spermatozoa to move more freely.The protein encoded by this gene is the predominant protein in semen. The encoded secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly having a separate function. The proteolysis process breaks down the gel matrix and allows the spermatozoa to move more freely. Two transcript variants encoding different isoforms have been found for this gene.
Protein Interactions FBXW4; SUMO2; PIK3R2; UBQLN4; CDK2; UBC; TGM1; SEMG2; PRKCA; KLK3; KLK2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-SEMG1 (ARP42088_T100) antibody is Catalog # AAP42088 (Previous Catalog # AAPP24567)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SEMG1
Complete computational species homology data Anti-SEMG1 (ARP42088_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SEMG1.
Swissprot Id P04279
Protein Name Semenogelin-1
Protein Accession # NP_002998
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SEMG1.
Nucleotide Accession # NM_003007
Replacement Item This antibody may replace item sc-33819 from Santa Cruz Biotechnology.
Conjugation Options

ARP42088_T100-FITC Conjugated

ARP42088_T100-HRP Conjugated

ARP42088_T100-Biotin Conjugated

CB Replacement sc-33819; sc-34716; sc-34717; sc-34718; sc-34719; sc-365939; sc-44416
Tested Species Reactivity Human
Predicted Species Reactivity Human, Pig
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Pig: 86%
Image 1
Human Lung
Rabbit Anti-SEMG1 Antibody
Catalog Number: ARP42088
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human Kidney
Rabbit Anti-SEMG1 Antibody
Catalog Number: ARP42088
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 3
Human Ovary Tumor
Host: Rabbit
Target Name: SEMG1
Sample Tissue: Human Ovary Tumor
Antibody Dilution: 1.0ug/ml

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 |