KISS1 Antibody : FITC (ARP42026_P050-FITC)

Data Sheet
 
Product Number ARP42026_P050-FITC
Product Page www.avivasysbio.com/kiss1-antibody-fitc-arp42026-p050-fitc.html
Name KISS1 Antibody : FITC (ARP42026_P050-FITC)
Gene Symbol KISS1
Alias Symbols HH13, KiSS-1,
Protein Size (# AA) 138 amino acids
Molecular Weight 15 kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
NCBI Gene Id 3814
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Official Gene Full Name KiSS-1 metastasis-suppressor
Peptide Sequence Synthetic peptide located within the following region: SWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTE
Description of Target This gene is a metastasis suppressor gene that suppresses metastases of melanomas and breast carcinomas without affecting tumorigenicity. The encoded protein may inhibit chemotaxis and invasion and thereby attenuate metastasis in malignant melanomas. Studies suggest a putative role in the regulation of events downstream of cell-matrix adhesion, perhaps involving cytoskeletal reorganization. A protein product of this gene, kisspeptin, stimulates gonadotropin-releasing hormone (GnRH)-induced gonadotropin secretion and regulates the pubertal activation of GnRH nuerons. A polymorphism in the terminal exon of this mRNA results in two protein isoforms. An adenosine present at the polymorphic site represents the third position in a stop codon. When the adenosine is absent, a downstream stop codon is utilized and the encoded protein extends for an additional seven amino acid residues.
Protein Interactions APP; KISS1R; MMP24; MMP16; MMP14; MMP9; MMP2;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-KISS1 (ARP42026_P050-FITC) antibody
Blocking Peptide Available upon request
Immunogen The immunogen is a synthetic peptide directed towards the following sequence SWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTE
Complete computational species homology data Anti-KISS1 (ARP42026_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KISS1.
Swissprot Id Q15726
Protein Name Metastasis-suppressor KiSS-1
Protein Accession # NP_002247
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KISS1.
Nucleotide Accession # NM_002256
Predicted Species Reactivity Human
Predicted Homology Based on Immunogen Sequence Human: 100%
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com