FGF2 Antibody - middle region (ARP42005_P050)

• Product Number: ARP42005_P050
• Name: FGF2 Antibody - middle region (ARP42005_P050)
• Protein Size (# AA): 288 amino acids
• Molecular Weight: 31 kDa
• NCBI Gene Id: 2247
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Fibroblast growth factor 2 (basic)
• Description:
  View product citations for FGF2 Antibody - middle region (ARP42005_P050) on CiteAb
• Alias Symbols: BFGF, FGFB, FGF-2, HBGF-2
• Peptide Sequence: Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Goodger,S.J., (2008) J. Biol. Chem. 283 (19), 13001-13008
• Description of Target: The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: TUBG1; HMT1; PRMT1; CRYAB; THBS1; UBC; API5; CEP57; FGFRL1; FGFBP1; CXCL13; RPL6; RPS19; PTX3; NRP1; GPC4; RPS6KA3; GPC3; VTN; SDC3; SDC1; PF4; HSPG2; SDC2; FGFR1; FGFR4; FGFR3; FGF2; CSNK2A2; CSNK2B; CSNK2A1; CD44; SDC4;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  SPR Affinity Characterization
  
• Blocking Peptide: For anti-FGF2 (ARP42005_P050) antibody is Catalog # AAP42005 (Previous Catalog # AAPS11410)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FGF2
• Uniprot ID: P09038
• Protein Name: Fibroblast growth factor 2
• Publications:

  MicroRNA-205 mediates endothelial progenitor functions in distraction osteogenesis by targeting the transcription regulator NOTCH2. Stem Cell Res Ther. 12, 101 (2021). 33536058

• Protein Accession #: NP_001997
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002006
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: FGF2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 86%
• Image 1: Human A375
  
  Sample Type:
  Human A375 cells
  Primary Antibody Dilution:
  1:100
  Secondary Antibody:
  Anti-rabbit-Alexa-546
  Secondary Antibody Dilution:
  1:100
  Color/Signal Descriptions:
  Red: FGF2 Blue: Nuclei
  Gene Name:
  FGF2
  Submitted by:
  Igor Prudovsky, PhD, DSc, Principal Investigator, Center for Molecular Medicine, Maine Medical Center Research Institute, 81 Research Dr. Scarborough, ME 4074
• Image 2: Human Ovary
  
  Rabbit Anti-FGF2 Antibody
  Catalog Number: ARP42005_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Ovary Tissue
  Observed Staining: Nucleus
  Primary Antibody Concentration: 1:600
  Other Working Concentrations: N/A
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
• Image 3: Mouse Skeletal Muscle
  
  Host: Mouse
  Target Name: FGF2
  Sample Tissue: Mouse Skeletal Muscle
  Antibody Dilution: 1ug/ml
• Image 4:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
• Image 5:
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The peptide is present in isoforms of 31, 23, 21 and 17 kDa. The protein is processed to 16 kDa mature form, and the protein may be modified via methylation, phosphorylation and/or sumoylation.