Product Number |
ARP41999_P050 |
Product Page |
www.avivasysbio.com/f13b-antibody-middle-region-arp41999-p050.html |
Name |
F13B Antibody - middle region (ARP41999_P050) |
Protein Size (# AA) |
661 amino acids |
Molecular Weight |
73kDa |
NCBI Gene Id |
2165 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Coagulation factor XIII, B polypeptide |
Alias Symbols |
FXIIIB |
Peptide Sequence |
Synthetic peptide located within the following region: LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Pruissen,D.M., (2008) Blood 111 (3), 1282-1286 |
Description of Target |
F13B contains 10 Sushi (CCP/SCR) domains. The B chain of factor XIII is not catalytically active, but is thought to stabilize the A subunits and regulate the rate of transglutaminase formation by thrombin. Defects in F13B can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion.This gene encodes coagulation factor XIII B subunit. Coagulation factor XIII is the last zymogen to become activated in the blood coagulation cascade. Plasma factor XIII is a heterotetramer composed of 2 A subunits and 2 B subunits. The A subunits have catalytic function, and the B subunits do not have enzymatic activity and may serve as a plasma carrier molecules. Platelet factor XIII is comprised only of 2 A subunits, which are identical to those of plasma origin. Upon activation by the cleavage of the activation peptide by thrombin and in the presence of calcium ion, the plasma factor XIII dissociates its B subunits and yields the same active enzyme, factor XIIIa, as platelet factor XIII. This enzyme acts as a transglutaminase to catalyze the formation of gamma-glutamyl-epsilon-lysine crosslinking between fibrin molecules, thus stabilizing the fibrin clot. Factor XIII deficiency is classified into two categories: type I deficiency, characterized by the lack of both the A and B subunits; and type II deficiency, characterized by the lack of the A subunit alone. These defects can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
FGG; F13A1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-F13B (ARP41999_P050) antibody |
Blocking Peptide |
For anti-F13B (ARP41999_P050) antibody is Catalog # AAP41999 (Previous Catalog # AAPS11404) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human F13B |
Uniprot ID |
P05160 |
Protein Name |
Coagulation factor XIII B chain |
Protein Accession # |
NP_001985 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001994 |
Tested Species Reactivity |
Human |
Gene Symbol |
F13B |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Human Fetal Liver
| Rabbit Anti-F13B antibody Catalog Number: ARP41999 Formalin Fixed Paraffin Embedded Tissue: Human Fetal Liver Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec
|
|
Image 2 | Human Vessel
| Rabbit Anti-F13B antibody Catalog Number: ARP41999 Formalin Fixed Paraffin Embedded Tissue: Human Vessel Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec
|
|
Image 3 | Human DLD1
| Host: Rabbit Target Name: F13B Sample Tissue: Human DLD1 Antibody Dilution: 1.0ug/ml |
|