F13B Antibody - middle region (ARP41999_P050)

Data Sheet
 
Product Number ARP41999_P050
Product Page www.avivasysbio.com/f13b-antibody-middle-region-arp41999-p050.html
Name F13B Antibody - middle region (ARP41999_P050)
Protein Size (# AA) 661 amino acids
Molecular Weight 73kDa
NCBI Gene Id 2165
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Coagulation factor XIII, B polypeptide
Alias Symbols FXIIIB
Peptide Sequence Synthetic peptide located within the following region: LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Pruissen,D.M., (2008) Blood 111 (3), 1282-1286
Description of Target F13B contains 10 Sushi (CCP/SCR) domains. The B chain of factor XIII is not catalytically active, but is thought to stabilize the A subunits and regulate the rate of transglutaminase formation by thrombin. Defects in F13B can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion.This gene encodes coagulation factor XIII B subunit. Coagulation factor XIII is the last zymogen to become activated in the blood coagulation cascade. Plasma factor XIII is a heterotetramer composed of 2 A subunits and 2 B subunits. The A subunits have catalytic function, and the B subunits do not have enzymatic activity and may serve as a plasma carrier molecules. Platelet factor XIII is comprised only of 2 A subunits, which are identical to those of plasma origin. Upon activation by the cleavage of the activation peptide by thrombin and in the presence of calcium ion, the plasma factor XIII dissociates its B subunits and yields the same active enzyme, factor XIIIa, as platelet factor XIII. This enzyme acts as a transglutaminase to catalyze the formation of gamma-glutamyl-epsilon-lysine crosslinking between fibrin molecules, thus stabilizing the fibrin clot. Factor XIII deficiency is classified into two categories: type I deficiency, characterized by the lack of both the A and B subunits; and type II deficiency, characterized by the lack of the A subunit alone. These defects can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions FGG; F13A1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-F13B (ARP41999_P050) antibody
Blocking Peptide For anti-F13B (ARP41999_P050) antibody is Catalog # AAP41999 (Previous Catalog # AAPS11404)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human F13B
Uniprot ID P05160
Protein Name Coagulation factor XIII B chain
Protein Accession # NP_001985
Purification Affinity Purified
Nucleotide Accession # NM_001994
Tested Species Reactivity Human
Gene Symbol F13B
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human Fetal Liver
Rabbit Anti-F13B antibody
Catalog Number: ARP41999
Formalin Fixed Paraffin Embedded Tissue: Human Fetal Liver
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
Image 2
Human Vessel
Rabbit Anti-F13B antibody
Catalog Number: ARP41999
Formalin Fixed Paraffin Embedded Tissue: Human Vessel
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
Image 3
Human DLD1
Host: Rabbit
Target Name: F13B
Sample Tissue: Human DLD1
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com