BDNF Antibody - middle region (ARP41970_P050)

Data Sheet
 
Product Number ARP41970_P050
Product Page www.avivasysbio.com/bdnf-antibody-middle-region-arp41970-p050.html
Name BDNF Antibody - middle region (ARP41970_P050)
Protein Size (# AA) 247 amino acids
Molecular Weight 28 kDa
NCBI Gene Id 627
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Brain-derived neurotrophic factor
Description
Alias Symbols ANON2, BULN2
Peptide Sequence Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hashimoto,R., (2008) Neurosci. Res. 61 (4), 360-367
Description of Target BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene, but the full-length nature of only some could be determined.
Protein Interactions UBC; AGO3; INPP5K; F11R; JUNB; APP; ELAVL1; Ntrk2; CADPS2; MBTPS1; SORT1; NOS3; NTF4; NTF3; ESR1; NCAM1; CPE; BDNF
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-BDNF (ARP41970_P050) antibody
Blocking Peptide For anti-BDNF (ARP41970_P050) antibody is Catalog # AAP41970 (Previous Catalog # AAPS11111)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human BDNF
Uniprot ID P23560
Protein Name Brain-derived neurotrophic factor
Publications

Horibe, I. et al. Induction of melanogenesis by 4’-O-methylated flavonoids in B16F10 melanoma cells. J. Nat. Med. 67, 705-10 (2013). 23242310

McCarthy, D. M. et al. Cocaine alters BDNF expression and neuronal migration in the embryonic mouse forebrain. J. Neurosci. 31, 13400-11 (2011). 21940433

Prenatal Cocaine Exposure Alters BDNF-TrkB Signaling in the Embryonic and Adult Brain. Dev. Neurosci. 38, 365-374 (2016). 28132054

Reversal Learning Deficits Associated with Increased Frontal Cortical Brain-Derived Neurotrophic Factor Tyrosine Kinase B Signaling in a Prenatal Cocaine Exposure Mouse Model. Dev. Neurosci. 38, 354-364 (2016). 27951531

Sex differences and estrogen regulation of BDNF gene expression, but not propeptide content, in the developing hippocampus. J. Neurosci. Res. 95, 345-354 (2017). 27870444

The Bdnf and Npas4 genes are targets of HDAC3-mediated transcriptional repression. BMC Neurosci. 20, 65 (2019). 31883511

TrkB/BDNF signalling patterns the sympathetic nervous system. Nat Commun. 6, 8281 (2015). 26404565

Protein Accession # NP_001700
Purification Affinity Purified
Nucleotide Accession # NM_001709
Tested Species Reactivity Human, Mouse, Monkey
Gene Symbol BDNF
Predicted Species Reactivity Human, Mouse, Rat, Dog, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Rhesus macaque spinal cord
Sample Type:
Rhesus macaque spinal cord
Primary Antibody Dilution:
1:300
Secondary Antibody:
Donkey anti Rabbit 488
Secondary Antibody Dilution:
1:500
Color/Signal Descriptions:
Green: BDNF
Gene Name:
BDNF
Submitted by:
Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706
Image 2
Ventral horn region of mouse spinal cord
Sample Type:
Ventral horn region of mouse spinal cord
Primary Antibody Dilution:
1:200
Secondary Antibody:
Donkey anti-rabbit CY2
Secondary Antibody Dilution:
1:500
Color/Signal Descriptions:
Green:BDNF
Gene Name:
BDNF
Submitted by:
Anonymous
Image 3
Mouse Brain
Host: Mouse
Target Name: BDNF
Sample Tissue: Mouse Brain
Antibody Dilution: 1ug/ml
Image 4
Mouse Pancreas
Host: Mouse
Target Name: BDNF
Sample Tissue: Mouse Pancreas
Antibody Dilution: 1ug/ml
Image 5
Human Ovary Tumor
Host: Rabbit
Target Name: BDNF
Sample Tissue: Human Ovary Tumor
Antibody Dilution: 1ug/ml
Image 6

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com