BDNF Antibody - N-terminal region : Biotin (ARP41969_P050-Biotin)

Data Sheet
 
Product Number ARP41969_P050-Biotin
Product Page www.avivasysbio.com/bdnf-antibody-n-terminal-region-biotin-arp41969-p050-biotin.html
Name BDNF Antibody - N-terminal region : Biotin (ARP41969_P050-Biotin)
Protein Size (# AA) 329 amino acids
Molecular Weight 36kDa
Conjugation Biotin
NCBI Gene Id 627
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name brain-derived neurotrophic factor
Alias Symbols ANON2, BULN2
Peptide Sequence Synthetic peptide located within the following region: EELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene.
Protein Interactions UBC; AGO3; INPP5K; F11R; JUNB; APP; ELAVL1; Ntrk2; CADPS2; MBTPS1; SORT1; NOS3; NTF4; NTF3; ESR1; NCAM1; CPE; BDNF;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-BDNF (ARP41969_P050-Biotin) antibody
Blocking Peptide For anti-BDNF (ARP41969_P050-Biotin) antibody is Catalog # AAP41969
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human BDNF
Uniprot ID P23560-4
Protein Name Brain-derived neurotrophic factor
Purification Affinity Purified
Gene Symbol BDNF
Predicted Species Reactivity Human, Mouse, Rat, Dog, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com