APCS Antibody - N-terminal region (ARP41962_T100)

Data Sheet
 
Product Number ARP41962_T100
Product Page www.avivasysbio.com/apcs-antibody-n-terminal-region-arp41962-t100.html
Name APCS Antibody - N-terminal region (ARP41962_T100)
Protein Size (# AA) 223 amino acids
Molecular Weight 25kDa
NCBI Gene Id 325
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Amyloid P component, serum
Alias Symbols SAP, PTX2, HEL-S-92n
Peptide Sequence Synthetic peptide located within the following region: NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Veerhuis,R., Neurobiol. Dis. 19 (1-2), 273-282 (2005)
Description of Target APCS is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo.The protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the encoded protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo. This gene has multiple polyadenylation sites.
Protein Interactions COPS5; GK; HES1; GRB2; GOT2; FCGR3B; FCGR2B; CALU; TG; LAMA1; FCGR1A; FCGR3A; FN1; CRP; C4BPA; C1QA; COL4A1; APCS;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-APCS (ARP41962_T100) antibody
Blocking Peptide For anti-APCS (ARP41962_T100) antibody is Catalog # AAP41962 (Previous Catalog # AAPS11103)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human APCS
Uniprot ID P02743
Protein Name Serum amyloid P-component
Protein Accession # NP_001630
Purification Protein A purified
Nucleotide Accession # NM_001639
Tested Species Reactivity Human
Gene Symbol APCS
Predicted Species Reactivity Human, Mouse, Rat, Guinea Pig
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Guinea Pig: 86%; Human: 100%; Mouse: 77%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-APCS Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
Image 2
Human Intestine
Rabbit Anti-APCS Antibody
Catalog Number: ARP41962
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com