ADCYAP1 Antibody (ARP41916_P050)

Data Sheet
Product Number ARP41916_P050
Product Page
Name ADCYAP1 Antibody (ARP41916_P050)
Gene Symbol ADCYAP1
Alias Symbols PACAP,
Protein Size (# AA) 176 amino acids
Molecular Weight 19 kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 116
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name adenylate cyclase activating polypeptide 1 (pituitary)
Peptide Sequence Synthetic peptide located within the following region: SAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGG
Protein Interactions VIPR2; SHH; CASP2; VIPR1; SCTR; MME; ADCYAP1R1; CPAMD8;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ADCYAP1 (ARP41916_P050) antibody
Blocking Peptide Available upon request
Immunogen The immunogen is a synthetic peptide directed towards the following sequence SAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGG
Complete computational species homology data Anti-ADCYAP1 (ARP41916_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ADCYAP1.
Swissprot Id P18509
Protein Name Pituitary adenylate cyclase-activating polypeptide

Pituitary adenylate cyclase-activating polypeptide (PACAP) contributes to the proliferation of hematopoietic progenitor cells in murine bone marrow via PACAP-specific receptor. Sci Rep. 6, 22373 (2016). Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 26925806

Protein Accession # NP_001108
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ADCYAP1.
Nucleotide Accession # NM_001099733
Predicted Species Reactivity Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence Cow: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%; Sheep: 86%

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 |