Product Number |
ARP41908_P050 |
Product Page |
www.avivasysbio.com/abp1-antibody-c-terminal-region-arp41908-p050.html |
Name |
ABP1 Antibody - C-terminal region (ARP41908_P050) |
Protein Size (# AA) |
751 amino acids |
Molecular Weight |
83kDa |
NCBI Gene Id |
26 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Amiloride binding protein 1 (amine oxidase (copper-containing)) |
Description |
|
Alias Symbols |
ABP, DAO, KAO, ABP1, DAO1 |
Peptide Sequence |
Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Boomsma,F., (2005) Diabetologia 48 (5), 1002-1007 |
Description of Target |
ABP1 is a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.This gene encodes a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. |
Protein Interactions |
DAO; DNM2; FGD1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-AOC1 (ARP41908_P050) antibody |
Additional Information |
IHC Information: HepG2 cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 8%. |
Blocking Peptide |
For anti-AOC1 (ARP41908_P050) antibody is Catalog # AAP41908 (Previous Catalog # AAPP12525) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ABP1 |
Uniprot ID |
P19801 |
Protein Name |
Amiloride-sensitive amine oxidase [copper-containing] |
Publications |
Liang, X.-H. et al. Estrogen regulates amiloride-binding protein 1 through CCAAT/enhancer-binding protein-beta in mouse uterus during embryo implantation and decidualization. Endocrinology 151, 5007-16 (2010). 20668027
Newly developed reversible MAO-B inhibitor circumvents the shortcomings of irreversible inhibitors in Alzheimer's disease. Sci Adv. 5, eaav0316 (2019). 30906861 |
Protein Accession # |
NP_001082 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001091 |
Tested Species Reactivity |
Human |
Gene Symbol |
AOC1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93% |
Image 1 | Human HepG2
| WB Suggested Anti-ABP1 Antibody Titration: 1 ug/ml Positive Control: HepG2 cell lysate |
|
Image 2 | Human kidney
| Rabbit Anti-ABP1 Antibody Catalog Number: ARP41908 Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|