ABP1 Antibody - C-terminal region (ARP41908_P050)

Data Sheet
 
Product Number ARP41908_P050
Product Page www.avivasysbio.com/abp1-antibody-c-terminal-region-arp41908-p050.html
Name ABP1 Antibody - C-terminal region (ARP41908_P050)
Protein Size (# AA) 751 amino acids
Molecular Weight 83kDa
NCBI Gene Id 26
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Amiloride binding protein 1 (amine oxidase (copper-containing))
Description
Alias Symbols ABP, DAO, KAO, ABP1, DAO1
Peptide Sequence Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Boomsma,F., (2005) Diabetologia 48 (5), 1002-1007
Description of Target ABP1 is a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.This gene encodes a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.
Protein Interactions DAO; DNM2; FGD1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-AOC1 (ARP41908_P050) antibody
Additional Information IHC Information: HepG2 cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 8%.
Blocking Peptide For anti-AOC1 (ARP41908_P050) antibody is Catalog # AAP41908 (Previous Catalog # AAPP12525)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ABP1
Uniprot ID P19801
Protein Name Amiloride-sensitive amine oxidase [copper-containing]
Publications

Liang, X.-H. et al. Estrogen regulates amiloride-binding protein 1 through CCAAT/enhancer-binding protein-beta in mouse uterus during embryo implantation and decidualization. Endocrinology 151, 5007-16 (2010). 20668027

Newly developed reversible MAO-B inhibitor circumvents the shortcomings of irreversible inhibitors in Alzheimer's disease. Sci Adv. 5, eaav0316 (2019). 30906861

Protein Accession # NP_001082
Purification Affinity Purified
Nucleotide Accession # NM_001091
Tested Species Reactivity Human
Gene Symbol AOC1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Image 1
Human HepG2
WB Suggested Anti-ABP1 Antibody
Titration: 1 ug/ml
Positive Control: HepG2 cell lysate
Image 2
Human kidney
Rabbit Anti-ABP1 Antibody
Catalog Number: ARP41908
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com