Product Number |
ARP41836_P050 |
Product Page |
www.avivasysbio.com/ptgs1-antibody-middle-region-arp41836-p050.html |
Name |
PTGS1 Antibody - middle region (ARP41836_P050) |
Protein Size (# AA) |
599 amino acids |
Molecular Weight |
66kDa |
NCBI Gene Id |
5742 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase) |
Alias Symbols |
COX1, COX3, PHS1, PCOX1, PES-1, PGHS1, PTGHS, PGG/HS, PGHS-1 |
Peptide Sequence |
Synthetic peptide located within the following region: GFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Canzian,F., (2008) Eur. J. Cancer Prev. 17 (2), 178-183 |
Description of Target |
Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes PTGS1, which regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. PTGS1 is thought to be involved in cell-cell signaling and maintaining tissue homeostasis.Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes PTGS1, which regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. PTGS1 is thought to be involved in cell-cell signaling and maintaining tissue homeostasis. Alternative splicing of this gene generates two transcript variants. The expression of these two transcripts is differentially regulated by relevant cytokines and growth factors.Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes PTGS1, which regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. PTGS1 is thought to be involved in cell-cell signaling and maintaining tissue homeostasis. Alternative splicing of this gene generates two transcript variants. The expression of these two transcripts is differentially regulated by relevant cytokines and growth factors. |
Protein Interactions |
FBXO6; PTGS2; NCL; CAV2; CAV1; PTGIS; Dlg4; PTGS1; NUCB1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PTGS1 (ARP41836_P050) antibody |
Blocking Peptide |
For anti-PTGS1 (ARP41836_P050) antibody is Catalog # AAP41836 (Previous Catalog # AAPP10884) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PTGS1 |
Uniprot ID |
P23219 |
Protein Name |
Prostaglandin G/H synthase 1 |
Protein Accession # |
NP_000953 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000962 |
Tested Species Reactivity |
Human |
Gene Symbol |
PTGS1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Application |
WB, IHC |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 82% |
Image 1 | Transfected 293T
| WB Suggested Anti-PTGS1 Antibody Titration: 0.2-1 ug/ml Positive Control: Transfected 293T |
|
Image 2 | Human Pineal Tissue
| PTGS1 antibody - middle region (ARP41836_P050)
Catalog Number: ARP41836_P050
Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
Observed Staining: Nucleus in Human Pineal Tissue
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|