| Product Number |
ARP41829_P050 |
| Product Page |
www.avivasysbio.com/oxt-antibody-n-terminal-region-arp41829-p050.html |
| Name |
OXT Antibody - N-terminal region (ARP41829_P050) |
| Protein Size (# AA) |
125 amino acids |
| Molecular Weight |
9kDa |
| NCBI Gene Id |
5020 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Oxytocin, prepropeptide |
| Alias Symbols |
OT, OT-NPI, OXT-NPI |
| Peptide Sequence |
Synthetic peptide located within the following region: LGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
There are two proteins encoded by this gene, oxytocin and neurophysin I. Oxytocin is posterior pituitary hormone which is synthesized as an inactive precursor in the hypothalamus along with its carrier protein neurophysin I. Together with neurophysin, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis, where it is either stored or secreted into the bloodstream. The precursor seems to be activated while it is being transported along the axon to the posterior pituitary. This hormone contracts smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions. |
| Protein Interactions |
TXNDC17; ESR2; PREP; OXTR; KMT2A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-OXT (ARP41829_P050) antibody |
| Blocking Peptide |
For anti-OXT (ARP41829_P050) antibody is Catalog # AAP41829 |
| Uniprot ID |
P01178 |
| Protein Name |
Oxytocin-neurophysin 1 |
| Protein Accession # |
NP_000906 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000915 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
OXT |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 92%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 93%; Sheep: 85% |
| Image 1 | Human Jurkat
 | Host: Rabbit
Target Name: OXT
Sample Tissue: Human Jurkat
Antibody Dilution: 1ug/ml |
|
|
