CYP4F3 Antibody - N-terminal region (ARP41823_P050)

• Product Number: ARP41823_P050
• Name: CYP4F3 Antibody - N-terminal region (ARP41823_P050)
• Protein Size (# AA): 520 amino acids
• Molecular Weight: 60kDa
• NCBI Gene Id: 4051
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cytochrome P450, family 4, subfamily F, polypeptide 3
• Alias Symbols: CPF3, CYP4F, LTB4H, CYPIVF3
• Peptide Sequence: Synthetic peptide located within the following region: LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Dhar,M., (2008) J. Lipid Res. 49 (3), 612-624
• Description of Target: This gene, CYP4F3, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This prot
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CYP4F3 (ARP41823_P050) antibody is Catalog # AAP41823 (Previous Catalog # AAPP10947)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CYP4F3
• Uniprot ID: Q08477
• Protein Name: Leukotriene-B(4) omega-hydroxylase 2
• Sample Type Confirmation:

  CYP4F3 is supported by BioGPS gene expression data to be expressed in OVCAR3

• Protein Accession #: NP_000887
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000896
• Tested Species Reactivity: Human
• Gene Symbol: CYP4F3
• Predicted Species Reactivity: Human, Mouse, Rat, Dog
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Dog: 86%; Human: 100%; Mouse: 85%; Rat: 85%
• Image 1: Human OVCAR-3
  
  WB Suggested Anti-CYP4F3 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: OVCAR-3 cell lysateCYP4F3 is supported by BioGPS gene expression data to be expressed in OVCAR3
• Image 2: Human Adult Liver
  
  Rabbit Anti-CYP4F3 Antibody
  Catalog Number: ARP41823_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
  Observed Staining: Cytoplasm in hepatocytes, strong signal, moderate tissue distribution
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 – 2.0 sec
  Protocol located in Reviews and Data.