Product Number |
ARP41801_T100 |
Product Page |
www.avivasysbio.com/cyp3a7-antibody-middle-region-arp41801-t100.html |
Name |
CYP3A7 Antibody - middle region (ARP41801_T100) |
Protein Size (# AA) |
503 amino acids |
Molecular Weight |
57kDa |
NCBI Gene Id |
1551 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Cytochrome P450, family 3, subfamily A, polypeptide 7 |
Alias Symbols |
CP37, CYPIIIA7, P450HLp2, P450-HFLA, P-450111A7, P-450(HFL33) |
Peptide Sequence |
Synthetic peptide located within the following region: KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Sim,S.C., (2005) Pharmacogenet. Genomics 15 (9), 625-631 |
Description of Target |
CYP3A7 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1.This gene, CYP3A7, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Transcript variants have been described, but it is not known whether these transcripts are normally produced. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CYP3A7 (ARP41801_T100) antibody |
Blocking Peptide |
For anti-CYP3A7 (ARP41801_T100) antibody is Catalog # AAP41801 (Previous Catalog # AAPP10849) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CYP3A7 |
Uniprot ID |
P24462 |
Protein Name |
Cytochrome P450 3A7 |
Publications |
Van Peer, E. et al. Ontogeny of CYP3A and P-glycoprotein in the liver and the small intestine of the Göttingen minipig: an immunohistochemical evaluation. Basic Clin. Pharmacol. Toxicol. 114, 387-94 (2014). 24224644 |
Protein Accession # |
NP_000756 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_000765 |
Tested Species Reactivity |
Human |
Gene Symbol |
CYP3A7 |
Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 77%; Dog: 75%; Guinea Pig: 83%; Human: 100%; Rat: 85% |
Image 1 | Human Liver
| WB Suggested Anti-CYP3A7 Antibody Titration: 2.5ug/ml Positive Control: Human Liver |
|