ADH6 Antibody - middle region : HRP (ARP41789_T100-HRP)

Data Sheet
 
Product Number ARP41789_T100-HRP
Product Page www.avivasysbio.com/adh6-antibody-middle-region-hrp-arp41789-t100-hrp.html
Name ADH6 Antibody - middle region : HRP (ARP41789_T100-HRP)
Protein Size (# AA) 295 amino acids
Molecular Weight 32kDa
Conjugation HRP: Horseradish Peroxidase
NCBI Gene Id 130
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Alcohol dehydrogenase 6 (class V)
Alias Symbols ADH-5
Peptide Sequence Synthetic peptide located within the following region: AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Description of Target ADH6 is class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products.
Protein Interactions RPAIN; RASSF5; RSL1D1; ANKRD17; TNIP1; RPS29; KRAS; ARRB1;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-ADH6 (ARP41789_T100-HRP) antibody
Blocking Peptide For anti-ADH6 (ARP41789_T100-HRP) antibody is Catalog # AAP41789 (Previous Catalog # AAPP10837)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ADH6
Uniprot ID Q8IUN7
Protein Name ADH6 protein EMBL AAH39065.1
Sample Type Confirmation

ADH6 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # AAH39065
Nucleotide Accession # NM_000672
Gene Symbol ADH6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 79%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com