Product Number |
ARP41789_T100-FITC |
Product Page |
www.avivasysbio.com/adh6-antibody-middle-region-fitc-arp41789-t100-fitc.html |
Name |
ADH6 Antibody - middle region : FITC (ARP41789_T100-FITC) |
Protein Size (# AA) |
295 amino acids |
Molecular Weight |
32kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
130 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Alcohol dehydrogenase 6 (class V) |
Alias Symbols |
ADH-5 |
Peptide Sequence |
Synthetic peptide located within the following region: AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
ADH6 is class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. |
Protein Interactions |
RPAIN; RASSF5; RSL1D1; ANKRD17; TNIP1; RPS29; KRAS; ARRB1; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-ADH6 (ARP41789_T100-FITC) antibody |
Blocking Peptide |
For anti-ADH6 (ARP41789_T100-FITC) antibody is Catalog # AAP41789 (Previous Catalog # AAPP10837) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ADH6 |
Uniprot ID |
Q8IUN7 |
Protein Name |
ADH6 protein EMBL AAH39065.1 |
Sample Type Confirmation |
ADH6 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
AAH39065 |
Nucleotide Accession # |
NM_000672 |
Gene Symbol |
ADH6 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 79% |
Image 1 | |
|