| Product Number |
ARP41789_T100 |
| Product Page |
www.avivasysbio.com/adh6-antibody-middle-region-arp41789-t100.html |
| Name |
ADH6 Antibody - middle region (ARP41789_T100) |
| Protein Size (# AA) |
295 amino acids |
| Molecular Weight |
32kDa |
| NCBI Gene Id |
130 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Alcohol dehydrogenase 6 (class V) |
| Alias Symbols |
ADH-5 |
| Peptide Sequence |
Synthetic peptide located within the following region: AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
ADH6 is class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. |
| Protein Interactions |
RPAIN; RASSF5; RSL1D1; ANKRD17; TNIP1; RPS29; KRAS; ARRB1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ADH6 (ARP41789_T100) antibody |
| Blocking Peptide |
For anti-ADH6 (ARP41789_T100) antibody is Catalog # AAP41789 (Previous Catalog # AAPP10837) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ADH6 |
| Uniprot ID |
Q8IUN7 |
| Protein Name |
ADH6 protein EMBL AAH39065.1 |
| Publications |
Retinoid regulation of antiviral innate immunity in hepatocytes. Hepatology. 63, 1783-95 (2016). 26638120 |
| Sample Type Confirmation |
ADH6 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
AAH39065 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_000672 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ADH6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 79% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ADH6 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysateADH6 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells |
|
