GH1 Antibody - C-terminal region (ARP41762_P050)

Data Sheet
 
Product Number ARP41762_P050
Product Page www.avivasysbio.com/gh1-antibody-c-terminal-region-arp41762-p050.html
Name GH1 Antibody - C-terminal region (ARP41762_P050)
Protein Size (# AA) 202 amino acids
Molecular Weight 23kDa
NCBI Gene Id 2688
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Growth hormone 1
Alias Symbols GH, GHN, GH-N, GHB5, IGHD2, hGH-N, IGHD1A, IGHD1B
Peptide Sequence Synthetic peptide located within the following region: SDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Protein Interactions GHR; BAG3; BTRC; PRLR; GH1; SHC1; STRAP; LTA4H;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GH1 (ARP41762_P050) antibody
Blocking Peptide Available upon request
Uniprot ID P01241-2
Protein Name Somatotropin
Protein Accession # NP_072053
Purification Affinity Purified
Nucleotide Accession # NM_022559
Tested Species Reactivity Human
Gene Symbol GH1
Predicted Species Reactivity Human, Mouse, Rat, Dog, Goat, Guinea Pig, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 85%; Goat: 83%; Guinea Pig: 85%; Human: 100%; Mouse: 85%; Rabbit: 85%; Rat: 85%; Sheep: 83%
Image 1
Human Fetal Small Intestine
WB Suggested Anti-GH1 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Small Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com