| Product Number |
ARP41697_P050 |
| Product Page |
www.avivasysbio.com/lep-antibody-n-terminal-region-arp41697-p050.html |
| Name |
LEP Antibody - N-terminal region (ARP41697_P050) |
| Protein Size (# AA) |
167 amino acids |
| Molecular Weight |
19kDa |
| NCBI Gene Id |
3952 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
leptin |
| Description |
|
| Alias Symbols |
OB, OBS, LEPD |
| Peptide Sequence |
Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Souren,N.Y., (er) Int J Obes (Lond) (2008) In press |
| Description of Target |
This gene encodes a protein that is secreted by white adipocytes into the circulation and plays a major role in the regulation of energy homeostasis. Circulating leptin binds to the leptin receptor in the brain, which activates downstream signaling pathways that inhibit feeding and promote energy expenditure. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis, reproduction, bone formation and wound healing. Mutations in this gene and its regulatory regions cause severe obesity and morbid obesity with hypogonadism in human patients. A mutation in this gene has also been linked to type 2 diabetes mellitus development. |
| Protein Interactions |
Hk3; SIGLEC6; GHRL; LEPR; UCN; PRKAA2; CLU; CRP; A2M; STAT3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LEP (ARP41697_P050) antibody |
| Additional Information |
IHC Information: Placenta |
| Blocking Peptide |
For anti-LEP (ARP41697_P050) antibody is Catalog # AAP41697 (Previous Catalog # AAPP24340) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LEP |
| Uniprot ID |
P41159 |
| Protein Name |
leptin |
| Publications |
Different expression of leptin and IGF1 in the adult and prepubertal testis in dogs. Reprod. Domest. Anim. 52 Suppl 2, 187-192 (2017). 28101891
Leptin in the canine uterus and placenta: possible implications in pregnancy. Reprod Biol Endocrinol. 13, 13 (2015). 25871422 |
| Protein Accession # |
NP_000221 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000230 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LEP |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Goat: 91%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Sheep: 91% |
| Image 1 | Human Placenta
 | Placenta |
|
| Image 2 | Human Small Intestine
 | WB Suggested Anti-LEP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine |
|
| Image 3 | Human A549 Whole Cell
 | Host: Rabbit
Target Name: LEP
Sample Tissue: Human A549 Whole Cell
Antibody Dilution: 1ug/ml |
|
