LCAT Antibody - N-terminal region (ARP41695_T100)

• Product Number: ARP41695_T100
• Name: LCAT Antibody - N-terminal region (ARP41695_T100)
• Protein Size (# AA): 440 amino acids
• Molecular Weight: 48kDa
• NCBI Gene Id: 3931
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Lecithin-cholesterol acyltransferase
• Peptide Sequence: Synthetic peptide located within the following region: MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Calabresi,L., (2005) Arterioscler. Thromb. Vasc. Biol. 25 (9), 1972-1978
• Description of Target: LCAT is an extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in its gene have been found to cause fish-eye disease as well as LCAT deficiency.This gene encodes the extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in this gene have been found to cause fish-eye disease as well as LCAT deficiency.
• Protein Interactions: APOA1; EXOSC10; APOE; APOA2; A2M;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-LCAT (ARP41695_T100) antibody is Catalog # AAP41695 (Previous Catalog # AAPP24338)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LCAT
• Uniprot ID: P04180
• Protein Name: Phosphatidylcholine-sterol acyltransferase
• Publications:

  Surin, B. et al. LG3 fragment of endorepellin is a possible biomarker of severity in IgA nephropathy. Proteomics 13, 142-52 (2013). 23166663

• Sample Type Confirmation:

  LCAT is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_000220
• Purification: Protein A purified
• Nucleotide Accession #: NM_000229
• Tested Species Reactivity: Human
• Gene Symbol: LCAT
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-LCAT Antibody Titration: 5.0ug/ml
  Positive Control: HepG2 cell lysateLCAT is supported by BioGPS gene expression data to be expressed in HepG2