Product Number |
ARP41682_T100 |
Product Page |
www.avivasysbio.com/fech-antibody-n-terminal-region-arp41682-t100.html |
Name |
FECH Antibody - N-terminal region (ARP41682_T100) |
Protein Size (# AA) |
429 amino acids |
Molecular Weight |
47kDa |
NCBI Gene Id |
2235 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Ferrochelatase |
Description |
|
Alias Symbols |
EPP, FCE, EPP1 |
Peptide Sequence |
Synthetic peptide located within the following region: LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGM |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Maruyama,K. (2005) Blood 106 (3), 1098-1104 |
Description of Target |
Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria.Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria. Two transcript variants encoding different isoforms have been found for this gene. |
Protein Interactions |
PPP2R1A; UBC; NEDD8; MDM2; FBXO6; gag-pol; COPS5; COPS6; CUL3; ELAVL1; MINOS1; MME; USP42; USP20; ABCB7; FECH; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-FECH (ARP41682_T100) antibody |
Blocking Peptide |
For anti-FECH (ARP41682_T100) antibody is Catalog # AAP41682 (Previous Catalog # AAPP24325) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FECH |
Uniprot ID |
Q8NAN0 |
Protein Name |
Ferrochelatase, mitochondrial |
Publications |
Miyake, M. et al. siRNA-mediated knockdown of the heme synthesis and degradation pathways: modulation of treatment effect of 5-aminolevulinic acid-based photodynamic therapy in urothelial cancer cell lines. Photochem. Photobiol. 85, 1020-7 19320847 |
Sample Type Confirmation |
FECH is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_001012533 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001012515 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
FECH |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 86% |
Image 1 | Mouse brain mitochondria
| Lanes: 1. 6 ug mouse brain mitochondria extract 2. 6 ug mouse brain mitochondria extract 3. 6 ug mouse brain mitochondria extract Primary Antibody Dilution: 1:500 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1:3000 Gene Name: FECH Submitted by: Dr. Hao Zhu, University of Kansas Medical Center
|
|
Image 2 | Human Jurkat
| WB Suggested Anti-FECH Antibody Titration: 2.5ug/ml Positive Control: Jurkat cell lysateFECH is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells |
|
Image 3 | Hela, THP-1
| Host: Rabbit Target: FECH Positive control (+): Hela (HL) Negative control (-): THP-1 (N30) Antibody concentration: 3ug/ml |
|