FECH Antibody - N-terminal region (ARP41682_T100)

Data Sheet
 
Product Number ARP41682_T100
Product Page www.avivasysbio.com/fech-antibody-n-terminal-region-arp41682-t100.html
Name FECH Antibody - N-terminal region (ARP41682_T100)
Protein Size (# AA) 429 amino acids
Molecular Weight 47kDa
NCBI Gene Id 2235
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Ferrochelatase
Description
Alias Symbols EPP, FCE, EPP1
Peptide Sequence Synthetic peptide located within the following region: LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Maruyama,K. (2005) Blood 106 (3), 1098-1104
Description of Target Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria.Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria. Two transcript variants encoding different isoforms have been found for this gene.
Protein Interactions PPP2R1A; UBC; NEDD8; MDM2; FBXO6; gag-pol; COPS5; COPS6; CUL3; ELAVL1; MINOS1; MME; USP42; USP20; ABCB7; FECH;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FECH (ARP41682_T100) antibody
Blocking Peptide For anti-FECH (ARP41682_T100) antibody is Catalog # AAP41682 (Previous Catalog # AAPP24325)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FECH
Uniprot ID Q8NAN0
Protein Name Ferrochelatase, mitochondrial
Publications

Miyake, M. et al. siRNA-mediated knockdown of the heme synthesis and degradation pathways: modulation of treatment effect of 5-aminolevulinic acid-based photodynamic therapy in urothelial cancer cell lines. Photochem. Photobiol. 85, 1020-7 19320847

Sample Type Confirmation

FECH is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_001012533
Purification Protein A purified
Nucleotide Accession # NM_001012515
Tested Species Reactivity Human, Mouse
Gene Symbol FECH
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 86%
Image 1
Mouse brain mitochondria
Lanes:
1. 6 ug mouse brain mitochondria extract 2. 6 ug mouse brain mitochondria extract 3. 6 ug mouse brain mitochondria extract
Primary Antibody Dilution:
1:500
Secondary Antibody:
Anti-rabbit HRP
Secondary Antibody Dilution:
1:3000
Gene Name:
FECH
Submitted by:
Dr. Hao Zhu, University of Kansas Medical Center
Image 2
Human Jurkat
WB Suggested Anti-FECH Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysateFECH is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
Image 3
Hela, THP-1
Host: Rabbit
Target: FECH
Positive control (+): Hela (HL)
Negative control (-): THP-1 (N30)
Antibody concentration: 3ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com