FAH Antibody - C-terminal region (ARP41681_T100)

• Product Number: ARP41681_T100
• Name: FAH Antibody - C-terminal region (ARP41681_T100)
• Protein Size (# AA): 419 amino acids
• Molecular Weight: 46kDa
• NCBI Gene Id: 2184
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Fumarylacetoacetate hydrolase (fumarylacetoacetase)
• Peptide Sequence: Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Bliksrud,Y.T., (2005) J. Mol. Med. 83 (5), 406-410
• Description of Target: FAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia.This gene encodes the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia (HT).
• Protein Interactions: KRTAP10-8; ADAMTSL4; SERTAD1; TCF4; KRTAP5-9; UBC; EGFR;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
  IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
• Other Applications Image 1 Data: Sample Type: Human Liver and Mouse FAH KO liver
  Primary Dilution: 1:400
• Blocking Peptide: For anti-FAH (ARP41681_T100) antibody is Catalog # AAP41681 (Previous Catalog # AAPP24324)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FAH
• Uniprot ID: P16930
• Protein Name: Fumarylacetoacetase
• Publications:

  Functional and Biochemical Characterization of Hepatitis C Virus (HCV) Particles Produced in a Humanized Liver Mouse Model. J. Biol. Chem. 290, 23173-87 (2015). 26224633

  Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277

• Protein Accession #: NP_000128
• Purification: Protein A purified
• Nucleotide Accession #: NM_000137
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: FAH
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
• Image 1: Human Jurkat
  
  FAH antibody - C-terminal region (ARP41681_T100) validated by WB using Jurkat cell lysate at 2.5 ug/ml.
• Image 2: Human Kidney
  
  Rabbit Anti-FAH Antibody
  Catalog Number: ARP41681
  Paraffin Embedded Tissue: Human Kidney
  Cellular Data: Epithelial cells of renal tubule
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X
• Image 3: human liver, mouse KO
  
  Sample Type: Human Liver and Mouse FAH KO liverPrimary Dilution: 1:400
• Image 4: Mouse Testis
  
  Host: Mouse
  Target Name: FAH
  Sample Tissue: Mouse Testis
  Antibody Dilution: 1ug/ml