CYP2D6 Antibody - N-terminal region (ARP41675_T100)

Data Sheet
 
Product Number ARP41675_T100
Product Page www.avivasysbio.com/cyp2d6-antibody-n-terminal-region-arp41675-t100.html
Name CYP2D6 Antibody - N-terminal region (ARP41675_T100)
Protein Size (# AA) 497 amino acids
Molecular Weight 55kDa
NCBI Gene Id 1565
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Cytochrome P450, family 2, subfamily D, polypeptide 6
Alias Symbols CPD6, CYP2D, CYP2DL1, CYPIID6, P450C2D, P450DB1, CYP2D7AP, CYP2D7BP, CYP2D7P2, CYP2D8P2, P450-DB1
Peptide Sequence Synthetic peptide located within the following region: RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Rowland,P., (2006) J. Biol. Chem. 281 (11), 7614-7622
Description of Target CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein Interactions CYP2D6; CYP2C9; POR; CYB5A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CYP2D6 (ARP41675_T100) antibody
Blocking Peptide For anti-CYP2D6 (ARP41675_T100) antibody is Catalog # AAP41675 (Previous Catalog # AAPP24318)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CYP2D6
Uniprot ID P10635
Protein Name Cytochrome P450 2D6
Protein Accession # NP_000097
Purification Protein A purified
Nucleotide Accession # NM_000106
Tested Species Reactivity Human
Gene Symbol CYP2D6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 91%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 100%; Sheep: 86%; Zebrafish: 92%
Image 1
Human Kidney
Rabbit Anti-CYP2D6 Antibody
Catalog Number: ARP41675
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human Liver
WB Suggested Anti-CYP2D6 Antibody Titration: 2.5ug/ml
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com