Product Number |
ARP41667_T100-HRP |
Product Page |
www.avivasysbio.com/asl-antibody-middle-region-hrp-arp41667-t100-hrp.html |
Name |
ASL Antibody - middle region : HRP (ARP41667_T100-HRP) |
Protein Size (# AA) |
444 amino acids |
Molecular Weight |
49kDa |
Conjugation |
HRP: Horseradish Peroxidase |
NCBI Gene Id |
435 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Argininosuccinate lyase |
Alias Symbols |
ASAL |
Peptide Sequence |
Synthetic peptide located within the following region: LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGREDK |
Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Reference |
Tanaka,T., (2002) Tohoku J. Exp. Med. 198 (2), 119-124 |
Description of Target |
ASL is a member of the lyase 1 family. The protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in its gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency.This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described. |
Protein Interactions |
WDYHV1; ASL; GINS4; NCDN; TUFM; PDHA1; NEDD8; HK1; GDI1; BAG3; OVGP1; HMOX1; FBP1; CSNK2A2; UBC; QARS; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-ASL (ARP41667_T100-HRP) antibody |
Blocking Peptide |
For anti-ASL (ARP41667_T100-HRP) antibody is Catalog # AAP41667 (Previous Catalog # AAPP24311) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ASL |
Uniprot ID |
P04424 |
Protein Name |
Argininosuccinate lyase |
Publications |
Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). WB, Goat, Mouse, Bovine, Dog, Pig, Horse, Human, Rabbit, Rat, Guinea pig, Zebrafish, Yeast 24465277 |
Protein Accession # |
NP_001020115 |
Nucleotide Accession # |
NM_001024944 |
Gene Symbol |
ASL |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 93% |
Image 1 | |