ASL Antibody - middle region : HRP (ARP41667_T100-HRP)

Data Sheet
 
Product Number ARP41667_T100-HRP
Product Page www.avivasysbio.com/asl-antibody-middle-region-hrp-arp41667-t100-hrp.html
Name ASL Antibody - middle region : HRP (ARP41667_T100-HRP)
Protein Size (# AA) 444 amino acids
Molecular Weight 49kDa
Conjugation HRP: Horseradish Peroxidase
NCBI Gene Id 435
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Argininosuccinate lyase
Alias Symbols ASAL
Peptide Sequence Synthetic peptide located within the following region: LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGREDK
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reference Tanaka,T., (2002) Tohoku J. Exp. Med. 198 (2), 119-124
Description of Target ASL is a member of the lyase 1 family. The protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in its gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency.This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described.
Protein Interactions WDYHV1; ASL; GINS4; NCDN; TUFM; PDHA1; NEDD8; HK1; GDI1; BAG3; OVGP1; HMOX1; FBP1; CSNK2A2; UBC; QARS;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-ASL (ARP41667_T100-HRP) antibody
Blocking Peptide For anti-ASL (ARP41667_T100-HRP) antibody is Catalog # AAP41667 (Previous Catalog # AAPP24311)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ASL
Uniprot ID P04424
Protein Name Argininosuccinate lyase
Publications

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). WB, Goat, Mouse, Bovine, Dog, Pig, Horse, Human, Rabbit, Rat, Guinea pig, Zebrafish, Yeast 24465277

Protein Accession # NP_001020115
Nucleotide Accession # NM_001024944
Gene Symbol ASL
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 93%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com