ASL Antibody - middle region (ARP41667_T100)

Data Sheet
 
Product Number ARP41667_T100
Product Page www.avivasysbio.com/asl-antibody-middle-region-arp41667-t100.html
Name ASL Antibody - middle region (ARP41667_T100)
Protein Size (# AA) 444 amino acids
Molecular Weight 49kDa
NCBI Gene Id 435
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Argininosuccinate lyase
Alias Symbols ASAL
Peptide Sequence Synthetic peptide located within the following region: LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGREDK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Tanaka,T., (2002) Tohoku J. Exp. Med. 198 (2), 119-124
Description of Target ASL is a member of the lyase 1 family. The protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in its gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency.This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described.
Protein Interactions WDYHV1; ASL; GINS4; NCDN; TUFM; PDHA1; NEDD8; HK1; GDI1; BAG3; OVGP1; HMOX1; FBP1; CSNK2A2; UBC; QARS;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ASL (ARP41667_T100) antibody
Blocking Peptide For anti-ASL (ARP41667_T100) antibody is Catalog # AAP41667 (Previous Catalog # AAPP24311)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ASL
Uniprot ID P04424
Protein Name Argininosuccinate lyase
Publications

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277

Protein Accession # NP_001020115
Purification Protein A purified
Nucleotide Accession # NM_001024944
Tested Species Reactivity Human
Gene Symbol ASL
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 93%
Image 1
Human Liver
WB Suggested Anti-ASL Antibody Titration: 5.0ug/ml
Positive Control: Human Liver
Image 2
Human
Lanes:
Lane1: 10 ug COS-7 cell lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-rabbit HRP
Secondary Antibody Dilution:
1:2000
Gene Name:
ASL
Submitted by:
Shawn Elms. Georgia Health Science University
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com