Product Number |
ARP41667_T100 |
Product Page |
www.avivasysbio.com/asl-antibody-middle-region-arp41667-t100.html |
Name |
ASL Antibody - middle region (ARP41667_T100) |
Protein Size (# AA) |
444 amino acids |
Molecular Weight |
49kDa |
NCBI Gene Id |
435 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Argininosuccinate lyase |
Alias Symbols |
ASAL |
Peptide Sequence |
Synthetic peptide located within the following region: LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGREDK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Tanaka,T., (2002) Tohoku J. Exp. Med. 198 (2), 119-124 |
Description of Target |
ASL is a member of the lyase 1 family. The protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in its gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency.This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described. |
Protein Interactions |
WDYHV1; ASL; GINS4; NCDN; TUFM; PDHA1; NEDD8; HK1; GDI1; BAG3; OVGP1; HMOX1; FBP1; CSNK2A2; UBC; QARS; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ASL (ARP41667_T100) antibody |
Blocking Peptide |
For anti-ASL (ARP41667_T100) antibody is Catalog # AAP41667 (Previous Catalog # AAPP24311) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ASL |
Uniprot ID |
P04424 |
Protein Name |
Argininosuccinate lyase |
Publications |
Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277 |
Protein Accession # |
NP_001020115 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001024944 |
Tested Species Reactivity |
Human |
Gene Symbol |
ASL |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 93% |
Image 1 | Human Liver
| WB Suggested Anti-ASL Antibody Titration: 5.0ug/ml Positive Control: Human Liver |
|
Image 2 | Human
| Lanes: Lane1: 10 ug COS-7 cell lysate Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1:2000 Gene Name: ASL Submitted by: Shawn Elms. Georgia Health Science University
|
|