| Product Number |
ARP41657_P050 |
| Product Page |
www.avivasysbio.com/alad-antibody-middle-region-arp41657-p050.html |
| Name |
ALAD Antibody - middle region (ARP41657_P050) |
| Protein Size (# AA) |
359 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
210 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Aminolevulinate dehydratase |
| Description |
|
| Alias Symbols |
PBGS, ALADH |
| Peptide Sequence |
Synthetic peptide located within the following region: SVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tang,L., (2006) J. Biol. Chem. 281 (10), 6682-6690 |
| Description of Target |
The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria.The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Protein Interactions |
C14orf142; P3H1; RPRD1B; PPME1; LAP3; DBNL; HSPBP1; GPN1; WDR4; ACTR2; TOM1L1; ZPR1; OGT; SURF2; LPP; AGFG1; UBD; UBC; ALAD; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ALAD (ARP41657_P050) antibody |
| Blocking Peptide |
For anti-ALAD (ARP41657_P050) antibody is Catalog # AAP41657 (Previous Catalog # AAPP24301) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ALAD |
| Uniprot ID |
Q6ZMU0 |
| Protein Name |
Delta-aminolevulinic acid dehydratase RuleBase RU000515 |
| Publications |
Iron metabolic pathways in the processes of sponge plasticity. PLoS One. 15, e0228722 (2020). 32084159 |
| Sample Type Confirmation |
ALAD is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_001003945 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001003945 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ALAD |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Yeast: 86%; Zebrafish: 86% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ALAD Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysateALAD is supported by BioGPS gene expression data to be expressed in Jurkat |
|
| Image 2 | Human heart
 | Rabbit Anti-ALAD Antibody
Catalog Number: ARP41657_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
