HAMP Antibody - N-terminal region (ARP41620_P050)

• Product Number: ARP41620_P050
• Name: HAMP Antibody - N-terminal region (ARP41620_P050)
• Protein Size (# AA): 84 amino acids
• Molecular Weight: 9kDa
• NCBI Gene Id: 57817
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Hepcidin antimicrobial peptide
• Alias Symbols: HEPC, PLTR, HFE2B, LEAP1
• Peptide Sequence: Synthetic peptide located within the following region: MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Theurl,I., (2008) Blood 111 (4), 2392-2399
• Description of Target: The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature p
• Protein Interactions: CKAP4; VKORC1; SLC40A1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HAMP (ARP41620_P050) antibody is Catalog # AAP41620 (Previous Catalog # AAPS09712)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HAMP
• Uniprot ID: P81172
• Protein Name: Hepcidin
• Protein Accession #: NP_066998
• Purification: Affinity Purified
• Nucleotide Accession #: NM_021175
• Tested Species Reactivity: Human
• Gene Symbol: HAMP
• Predicted Species Reactivity: Human, Rat
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Rat: 83%
• Image 1: Human Spleen
  
  WB Suggested Anti-HAMP Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human Spleen