LAMP3 Antibody - N-terminal region (ARP41598_P050)

Data Sheet
 
Product Number ARP41598_P050
Product Page www.avivasysbio.com/lamp3-antibody-n-terminal-region-arp41598-p050.html
Name LAMP3 Antibody - N-terminal region (ARP41598_P050)
Protein Size (# AA) 416 amino acids
Molecular Weight 44kDa
NCBI Gene Id 27074
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Lysosomal-associated membrane protein 3
Description
Alias Symbols LAMP, CD208, DCLAMP, LAMP-3, TSC403, DC LAMP, DC-LAMP
Peptide Sequence Synthetic peptide located within the following region: YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lebre,M.C., (2008) Am. J. Pathol. 172 (4), 940-950
Description of Target LAMP3 might change the lysosome function after the transfer of peptide-MHC class II molecules to the surface of dendritic cells. LAMP3 overexpression is associated with an enhanced metastatic potential and may be a prognostic factor for cervical cancer.
Protein Interactions SGTB;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LAMP3 (ARP41598_P050) antibody
Blocking Peptide For anti-LAMP3 (ARP41598_P050) antibody is Catalog # AAP41598 (Previous Catalog # AAPP24281)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LAMP3
Uniprot ID Q9UQV4
Protein Name Lysosome-associated membrane glycoprotein 3
Publications

Lysosome-associated membrane glycoprotein 3 is involved in influenza A virus replication in human lung epithelial (A549) cells. Virol J. 8, 384 (2011). 21810281

Reduced glucocerebrosidase is associated with increased α-synuclein in sporadic Parkinson's disease. Brain. 137, 834-48 (2014). 24477431

Protein Accession # NP_055213
Purification Affinity Purified
Nucleotide Accession # NM_014398
Tested Species Reactivity Human
Gene Symbol LAMP3
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human MCF-7
WB Suggested Anti-LAMP3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate
Image 2
Human Lung, Human Brain
Host: Rabbit
Target: LAMP3
Positive control (+): Human Lung (LU)
Negative control (-): Human Brain (BR)
Antibody concentration: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com