Product Number |
ARP41598_P050 |
Product Page |
www.avivasysbio.com/lamp3-antibody-n-terminal-region-arp41598-p050.html |
Name |
LAMP3 Antibody - N-terminal region (ARP41598_P050) |
Protein Size (# AA) |
416 amino acids |
Molecular Weight |
44kDa |
NCBI Gene Id |
27074 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Lysosomal-associated membrane protein 3 |
Description |
|
Alias Symbols |
LAMP, CD208, DCLAMP, LAMP-3, TSC403, DC LAMP, DC-LAMP |
Peptide Sequence |
Synthetic peptide located within the following region: YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Lebre,M.C., (2008) Am. J. Pathol. 172 (4), 940-950 |
Description of Target |
LAMP3 might change the lysosome function after the transfer of peptide-MHC class II molecules to the surface of dendritic cells. LAMP3 overexpression is associated with an enhanced metastatic potential and may be a prognostic factor for cervical cancer. |
Protein Interactions |
SGTB; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LAMP3 (ARP41598_P050) antibody |
Blocking Peptide |
For anti-LAMP3 (ARP41598_P050) antibody is Catalog # AAP41598 (Previous Catalog # AAPP24281) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LAMP3 |
Uniprot ID |
Q9UQV4 |
Protein Name |
Lysosome-associated membrane glycoprotein 3 |
Publications |
Lysosome-associated membrane glycoprotein 3 is involved in influenza A virus replication in human lung epithelial (A549) cells. Virol J. 8, 384 (2011). 21810281
Reduced glucocerebrosidase is associated with increased α-synuclein in sporadic Parkinson's disease. Brain. 137, 834-48 (2014). 24477431 |
Protein Accession # |
NP_055213 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_014398 |
Tested Species Reactivity |
Human |
Gene Symbol |
LAMP3 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human MCF-7
| WB Suggested Anti-LAMP3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: MCF7 cell lysate |
|
Image 2 | Human Lung, Human Brain
| Host: Rabbit Target: LAMP3 Positive control (+): Human Lung (LU) Negative control (-): Human Brain (BR) Antibody concentration: 1ug/ml |
|