| Product Number |
ARP41577_P050-FITC |
| Product Page |
www.avivasysbio.com/ftcd-antibody-middle-region-fitc-arp41577-p050-fitc.html |
| Name |
FTCD Antibody - middle region : FITC (ARP41577_P050-FITC) |
| Protein Size (# AA) |
549 amino acids |
| Molecular Weight |
59kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
10841 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Formiminotransferase cyclodeaminase |
| Alias Symbols |
LCHC1 |
| Peptide Sequence |
Synthetic peptide located within the following region: KFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Hillman,R.T., Genome Biol. 5 (2), R8 (2004) |
| Description of Target |
FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool. FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.[supplied by OMIM]. |
| Protein Interactions |
CCDC155; MED4; TNKS2; GRB14; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-FTCD (ARP41577_P050-FITC) antibody |
| Additional Information |
IHC Information: Fetal liver cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%. |
| Blocking Peptide |
For anti-FTCD (ARP41577_P050-FITC) antibody is Catalog # AAP41577 (Previous Catalog # AAPP24262) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human FTCD |
| Uniprot ID |
O95954 |
| Protein Name |
Formimidoyltransferase-cyclodeaminase |
| Publications |
Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Human, Pig, Rat, Mouse, Bovine, Dog, Horse, Guinea pig, Zebrafish, Rabbit 23103828 |
| Protein Accession # |
NP_006648 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006657 |
| Gene Symbol |
FTCD |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 86% |
| Image 1 | |
