FTCD Antibody - middle region (ARP41577_P050)

Data Sheet
 
Product Number ARP41577_P050
Product Page www.avivasysbio.com/ftcd-antibody-middle-region-arp41577-p050.html
Name FTCD Antibody - middle region (ARP41577_P050)
Gene Symbol FTCD
Alias Symbols LCHC1
Protein Size (# AA) 549 amino acids
Molecular Weight 59kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 10841
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Formiminotransferase cyclodeaminase
Peptide Sequence Synthetic peptide located within the following region: KFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEK
Target Reference Hillman,R.T., Genome Biol. 5 (2), R8 (2004)
Description of Target FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool. FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.[supplied by OMIM].
Protein Interactions CCDC155; MED4; TNKS2; GRB14;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FTCD (ARP41577_P050) antibody
Additional Information IHC Information: Fetal liver cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Blocking Peptide For anti-FTCD (ARP41577_P050) antibody is Catalog # AAP41577 (Previous Catalog # AAPP24262)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FTCD
Complete computational species homology data Anti-FTCD (ARP41577_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FTCD.
Swissprot Id O95954
Protein Name Formimidoyltransferase-cyclodeaminase
Publications

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 23103828

Protein Accession # NP_006648
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FTCD.
Nucleotide Accession # NM_006657
Replacement Item This antibody may replace item sc-120329 from Santa Cruz Biotechnology.
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 86%
Image 1
Human Fetal liver
Immunohistochemistry with Fetal liver cell lysate tissue at an antibody concentration of 1.25 ug/ml using anti-FTCD antibody (ARP41577_P050)
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com