MB Antibody - N-terminal region (ARP41558_P050)

• Product Number: ARP41558_P050
• Name: MB Antibody - N-terminal region (ARP41558_P050)
• Protein Size (# AA): 154 amino acids
• Molecular Weight: 17kDa
• NCBI Gene Id: 4151
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Myoglobin
• Alias Symbols: PVALB
• Peptide Sequence: Synthetic peptide located within the following region: MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Forsman,M., (2008) J. Surg. Res. 146 (2), 271-275
• Description of Target: This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen. At least three alt
• Protein Interactions: APP; UBC; PSMD4;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MB (ARP41558_P050) antibody is Catalog # AAP41558 (Previous Catalog # AAPP24243)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MB
• Uniprot ID: P02144
• Protein Name: Myoglobin
• Protein Accession #: NP_005359
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005368
• Tested Species Reactivity: Human
• Gene Symbol: MB
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 79%; Goat: 86%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 85%; Pig: 86%; Rabbit: 86%; Rat: 79%; Sheep: 86%
• Image 1: Human HT1080
  
  WB Suggested Anti-MB Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: HT1080 cell lysate